KEGG   Bacteroides vulgatus: BVU_4136Help
Entry
BVU_4136          CDS       T00546                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bvu  Bacteroides vulgatus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bvu00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bvu00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5089308..5091362)
Genome map
AA seq 684 aa AA seqDB search
MRRLIILAEVALGLLFASCTKEEQRTLSVIPAPLKVELQQEVFSLNSETGLYIDASEGDK
KILEDYLVASSMNLKPVIAEEGHNVVLKQVAELPEVNSSEGYVLTVTPDQVLIRATSGAG
LFYGVQTMLQMVDEKGLPAGVITDEPRFAYRGFMMDVSRHFFDKEFIKKQMDALAYYKLN
RLHLHLTDAAGWRLEIKKYPRLTEFAAWREFPTWKEWWNNGRRYEEEGSKDAHGGYYTQD
DIRELVAYAQERFITVIPEIEMPAHSEEVLTAYPELSCTHEPYKQADFCVGNEKTFEFLE
NVLTEVMELFPSEYIHIGGDEAGKASWPTCKLCQARMKKEGLKDVNELQSYLIHRIEVFL
NAHGRKLLGWDEILEGGLAPNATVMSWRGTEGGMKAVDSGHMAIMSPGEFCYFDSYQDAP
DSQPEAIGGYLPLSKVYSFNPVPDTLSADKVQLVYGVQANLFTEYIPTPEHAEMMIYPRI
LALAEVAWSAPSVKNYDDFHVRALKEVEALKAEGYHPFELKNEIGNRPGADQPVQHLAVG
KKVAYGPDAAYYPGYSAGGDSALVDGVIGGWTYGDRRWQGFIDKKRMDVTIDMEKETEIH
SVGADFMQVCGPEVFMPSEVIISVSNDGKEFTELKRMEHKVVKDDKVTFINFGWEGNAKA
RYIRYQASSGEFGGFLFTDEIVVK
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgagaagattgattatattggcggaagttgcattgggcttgctgtttgcaagttgcacg
aaagaagagcaacgcacactttctgttattcccgcaccattaaaggtggaattacagcag
gaagtgttttcattgaattcggaaacagggttatatatagatgcgtctgagggggacaag
aagattttggaagattatctggtggcttcttccatgaatttgaaaccggtaatagcagaa
gagggacataatgttgtcttgaaacaagtggcggaactgccggaggtaaactcttccgag
ggatatgttctgacggtaactcctgatcaggtacttattcgtgcaacttccggggcagga
ttgttctatggagttcagactatgctgcaaatggttgatgaaaaaggattgccggcagga
gtcattacagatgaaccccgttttgcttatcgtggctttatgatggatgtttcccgtcat
ttcttcgataaggaatttataaaaaagcagatggatgctttggcatattataaattgaac
cgtctgcatctgcatcttactgacgctgcgggctggcgtcttgaaataaaaaaatatccc
cgtctgacagaatttgcggcatggcgtgagtttcctacctggaaagaatggtggaataac
ggacgacggtatgaagaagaaggcagtaaagatgctcacggaggttattatactcaagat
gatatccgcgaactggtggcatacgctcaggaacgttttattactgttattcctgagata
gagatgcctgcgcattcggaagaagtactgactgcttatcctgagttgtcttgtacacac
gaaccttacaaacaagccgatttctgtgtcggtaatgaaaagacttttgagtttctggaa
aatgtgttgacagaggtaatggaacttttcccgtccgaatatattcatataggaggggat
gaggcaggtaaagcctcatggcccacttgcaaactgtgccaggcacgtatgaaaaaagaa
ggcttgaaagatgtgaacgagttacagagttatctgattcatcgtattgaggtctttttg
aatgcccacggacgtaaattattgggttgggatgaaatattggaaggtggtttggcacct
aatgccactgtcatgtcatggcgtggcacggaagggggaatgaaagcggttgattccggc
cacatggctattatgagtccgggtgagttctgctattttgattcttatcaggatgctcct
gattcccagccggaagcaataggaggctatctgcctttgtccaaagtttattcatttaat
cctgtacccgatactttgagtgcggataaagtccagttggtgtatggagtacaagctaat
ttattcacagaatatattccgactccggaacatgcggaaatgatgatttatcctcgtatt
cttgccttggcggaagttgcttggagtgccccttctgtgaagaactatgatgattttcat
gttcgtgcattgaaagaggtagaggcattgaaagctgaaggataccatccttttgaattg
aaaaatgagataggaaatcgtccgggagcggatcagcccgtacagcatttggcagtaggt
aagaaagtggcttacggaccggatgccgcttattatcccggctattcggccggtggtgac
agtgccttggtagatggtgtgatcggaggctggacttatggtgacaggcgttggcaaggt
tttatagacaagaaaagaatggatgtgaccattgatatggaaaaagaaacagaaattcat
tctgttggagcagactttatgcaggtgtgtggacctgaagtctttatgccttcagaagtg
atcatttccgtttccaatgatggtaaggagtttacggaactgaagcgcatggagcataaa
gtagtgaaggatgacaaagtgactttcatcaactttggttgggaaggaaatgccaaagca
cgttacatacgttatcaggcatcttcgggcgaattcggaggtttcttgtttacagatgaa
attgtagtgaaataa

DBGET integrated database retrieval system