KEGG   Bacteroides vulgatus: BVU_4138Help
Entry
BVU_4138          CDS       T00546                                 

Definition
(GenBank) glycoside hydrolase family 20, candidate beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00511  Other glycan degradation
bvu00520  Amino sugar and nucleotide sugar metabolism
bvu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BVU_4138
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BVU_4138
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BVU_4138
Chaperones and folding catalysts [BR:bvu03110]
 Intramolecular chaperones
  Others
   BVU_4138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b F5_F8_type_C Fn3_assoc CHB_HEX_C_1 Glyco_hydro_67N
Motif
Other DBs
NCBI-ProteinID: ABR41740
UniProt: A6L7S6
Position
complement(5092673..5094997)
Genome map
AA seq 774 aa AA seqDB search
MKTLMGLAGLTMAGFMLLSCNTEVKEANYQIIPLPQEISVMDQAAPFILSNGTKIMYPEG
NEKMQKNAEFLASYIKDLTGKSLAVQAGTDGKGIILQLGGNAENPEGYQLKVTSDQVVIS
GPTEAGVFYGIQTLRKSIPVAQGVDIALPAVEINDYPRFSYRGAMLDVSRHFFPVDSVKR
FIDMLALHNINRFHWHLSEDQGWRIEIKSRPELTEIGSKRAETVIGHNSGKYDGKPYGGF
FTQEEAKEIVAYAAERHITVIPEIDMPGHMQAALAAYPNLGCTGGPYEVWKIWGVSEDVL
CAGNDETLKFIEDVLGEIIQIFPSEYIHVGGDECPKVRWAKCPKCQARIKALGLKSDKNH
TAEERLQSFIINHAEKFLNGHGRQIIGWDEILEGGLAPNATVMSWRGVAGGIEAAKQKHD
VIMTPNTYLYFDYYQTKDIANEPEAIGGYVPVETVYNYEPMPADLTPEEQKYIIGVQANL
WTEYIPTYSQVEYMELPRMAALSEIQWTMPEKKNYEGFLKRLPQLVDIYDVYKYNYAKHV
FDVNAVFTPNPKDGTLDVTLSTIDNSPIYYTLDGTEPSAASQLYTETLKLKQNCTFKAIT
VRPAGNSRVVTEEIAFNKASMKPVTMLQPVNKQYEFKGAPTLVDGLKGNGNYKTGRWIAF
YKNDMEAVIDMQQPTEISSASISTCVEKGDWVFDARAFSVAVSEDGKNFKEIASEKYPAM
KQDDKNGVFNHTLTFDPVTARYVKVTALAEHSIPAWHGGKGNPAFLFVDEISLN
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttaatgggccttgcagggctgacaatggcaggttttatgcttttatcctgt
aacacagaagtgaaagaagcaaattatcagataattccgttaccgcaggaaatttcggta
atggatcaggctgctccgtttattttgtcaaatggaactaagataatgtatccggaaggc
aatgaaaaaatgcaaaagaacgctgaatttttggcaagttatatcaaagatcttaccgga
aagtcattggctgtacaagccggtacagacggcaaaggaataatcctgcaattaggtgga
aatgctgaaaatcctgaaggataccagttaaaggtaaccagcgaccaagtggttatttca
ggacctacggaagccggagtattttatggcatccagacgttgcgtaaatctattccggta
gcacaaggagtggatatcgctttaccggcggttgaaatcaatgactatcctcgtttctct
tatcgtggtgcaatgttggatgtgtcacgtcattttttcccggtagattctgtaaagcgt
tttattgatatgctggctttgcacaacatcaaccgtttccactggcatttgtctgaagac
cagggatggagaatcgaaatcaagagtcgtcctgaactgactgaaataggttctaaaaga
gcggaaacggttatcggacataactcgggaaaatatgatggcaagccttatggtggattc
ttcacacaggaagaagcaaaagaaattgtagcttatgctgccgaacgtcatattacggtt
ataccggaaattgatatgccgggacacatgcaggctgctttggctgcatatcctaacttg
ggctgtactggtggtccgtacgaagtatggaaaatctggggggtatcagaagatgtgctt
tgcgcaggaaatgatgaaaccttgaaattcattgaagatgtattaggggaaattattcag
attttcccatcagaatatattcatgtaggtggtgacgaatgtcctaaggtacgttgggca
aaatgtccaaagtgccaggctcgtatcaaggctttaggtcttaagtctgacaagaatcat
actgccgaggaaagattgcagagtttcattatcaatcatgcagagaagttcctgaacgga
cacggacgtcagattatcggttgggatgaaattctggaaggcggattggctcccaatgcc
actgtaatgtcatggcgtggtgttgccggaggtattgaagccgcaaaacagaaacatgat
gtaattatgactcctaatacttatttgtatttcgactattaccaaaccaaggatattgct
aatgaacctgaggctattggtggatatgtacccgttgaaacagtatataactatgagccg
atgccggctgatctgactccggaagagcagaaatacatcattggcgtacaggccaactta
tggactgaatacattcctacctacagtcaggtagaatatatggaattaccccgtatggct
gctttgtctgaaattcagtggaccatgccggaaaagaaaaactatgaaggtttcttgaag
cgtttgcctcagttggtagatatttatgatgtttataaatataattatgccaagcatgtc
tttgatgtaaatgctgtatttactcctaatccgaaagatggtacgctggatgttactttg
tctactattgataatagtcctatctattacactttggatggaacggaaccttccgctgct
tcccagttgtatacggaaacattgaaattgaaacagaattgtacttttaaagcgattact
gtacgtcctgcaggaaatagccgtgtggttacagaggaaattgcttttaacaaggctagt
atgaaacctgtcactatgttgcaaccggtaaacaagcaatatgaattcaaaggcgctccc
actttggtggacggattgaaaggtaacggtaactataagacgggccgttggattgctttc
tataaaaatgatatggaagcagttattgatatgcagcaaccgacagaaatcagcagcgct
tctatttctacttgtgtggaaaaaggtgactgggtgtttgatgcccgtgctttttctgta
gctgtatccgaagacggaaagaactttaaggaaattgcttcagaaaaatatccggcaatg
aagcaggatgacaagaatggagtgttcaaccatacgttgactttcgatccggtgactgcc
cgttatgtgaaagtgaccgctttagcggaacatagcattcctgcttggcacggtggcaaa
ggaaatccggctttcttgtttgttgatgaaatttcattaaattga

DBGET integrated database retrieval system