KEGG   Bacillus weihenstephanensis: BcerKBAB4_0020Help
Entry
BcerKBAB4_0020    CDS       T00642                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bwe  Bacillus weihenstephanensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BcerKBAB4_0020 (recR)
DNA repair and recombination proteins [BR:bwe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BcerKBAB4_0020 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
27272..27868
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVC
GHITDRDPCYICDDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMEGIGPE
DINIPQLLKRLQDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccgatatcaaaattaatcgatagttttatgaagttgccaggaatc
ggaccgaaaacagcggttcgattggcattcttcgtgttagatatgaaagaggatgatgta
ctaggttttgcgaaagcacttgtgaatgcaaagcgagatttagcgtattgttctgtgtgc
ggacatatcactgaccgcgatccttgttatatttgtgacgattcgcatagggatcaatcg
gttgtttgtgtagtacaagagccgaaagatgtaattgcgatggaaaaaatgaaagaatat
caaggtgtatatcatgttttgcgtggtgccatttctccaatggagggaattggaccagag
gatattaatatcccgcagttattaaagagactgcaagatgaaacggtacaagaagtgata
ttagcaacaaaccctaatattgaaggggaagccacagcgatgtacatatcccgcctctta
aagccaacaggaattaaagtaactcgtattgcacatggtctgccagttggtggagattta
gaatatgcagatgaagtaacactatcgaaagctttagaaggccgtagagagatataa

DBGET integrated database retrieval system