KEGG   Bacillus mycoides KBAB4: BcerKBAB4_0020Help
Entry
BcerKBAB4_0020    CDS       T00642                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BcerKBAB4_0020
DNA repair and recombination proteins [BR:bwe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BcerKBAB4_0020
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BcerKBAB4_0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_8
Motif
Other DBs
NCBI-ProteinID: ABY41289
JGI: BcerKBAB40020
UniProt: A9VN38
Position
27272..27868
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVC
GHITDRDPCYICDDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMEGIGPE
DINIPQLLKRLQDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccgatatcaaaattaatcgatagttttatgaagttgccaggaatc
ggaccgaaaacagcggttcgattggcattcttcgtgttagatatgaaagaggatgatgta
ctaggttttgcgaaagcacttgtgaatgcaaagcgagatttagcgtattgttctgtgtgc
ggacatatcactgaccgcgatccttgttatatttgtgacgattcgcatagggatcaatcg
gttgtttgtgtagtacaagagccgaaagatgtaattgcgatggaaaaaatgaaagaatat
caaggtgtatatcatgttttgcgtggtgccatttctccaatggagggaattggaccagag
gatattaatatcccgcagttattaaagagactgcaagatgaaacggtacaagaagtgata
ttagcaacaaaccctaatattgaaggggaagccacagcgatgtacatatcccgcctctta
aagccaacaggaattaaagtaactcgtattgcacatggtctgccagttggtggagattta
gaatatgcagatgaagtaacactatcgaaagctttagaaggccgtagagagatataa

DBGET integrated database retrieval system