KEGG   Bacillus mycoides KBAB4: BcerKBAB4_0040Help
Entry
BcerKBAB4_0040    CDS       T00642                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00900  Terpenoid backbone biosynthesis
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01130  Biosynthesis of antibiotics
Module
bwe_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BcerKBAB4_0040
Enzymes [BR:bwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BcerKBAB4_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABY41309
JGI: BcerKBAB40040
UniProt: A9VN58
Position
47958..48827
Genome map
AA seq 289 aa AA seqDB search
MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELTELAEDRIEILSHNRYV
PDDQRNLAYQAAKLLKVKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLWNLG
LTIDELAKLGAEIGSDVSFCVYGGTAIATGRGEEIEHIKTPPSCWVVLAKPHIGVSTADV
YGNLKLNRVTHPNVDKMVEVINHGDYKGICDTVGNVLEDVTFAMHPEVARIKSQMKRFGA
DAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctactagtgaaagcaccagcaaagattaatctgtcgttagatgtactgggaaaa
agacaagatggatatcatgaagtgaaaatgattatgacaacaatcgacttggcagatcgt
ttagagctaacggaattagcagaagaccgtattgaaattttgtcccataatcggtatgtc
ccagacgaccaacgcaatttagcttatcaagcagcgaaattattaaaagtgaagtttaat
gtaaaaaaaggtgtgtctattactattgaaaaaacgattccagtagccgctggattagca
ggtggaagtagtgatgcagcagcgacattacgtggccttaataagttatggaatttaggg
ctaacaatcgatgaattagcaaagcttggcgcagaaattggatcagatgtatcgttctgt
gtatatggtggaactgctattgccactggaagaggagaagaaattgaacatataaagact
ccgccttcttgttgggttgttttagcaaagccccacattggtgtatctactgctgacgtg
tacggaaatttaaaattaaatcgtgttactcatccaaatgtagataaaatggttgaagtc
attaaccatggcgattataaaggaatttgtgatactgttggtaacgttttagaagatgtg
acgtttgcgatgcatcccgaggttgcacgtattaaatcacagatgaaacgctttggggca
gatgccgtattaatgagtggaagtggcccaactgtatttggtcttgtacaccatgattcg
cgaatgcaccgcatatataacgggttaaaaggattttgcgagcaagtatatgcagtgcgt
ttattaggagagcgagaaacgcttgaataa

DBGET integrated database retrieval system