KEGG   Bacillus weihenstephanensis: BcerKBAB4_0328Help
Entry
BcerKBAB4_0328    CDS       T00642                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bwe  Bacillus weihenstephanensis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BcerKBAB4_0328
Enzymes [BR:bwe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BcerKBAB4_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
378365..379006
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEVVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLDYYETTPEDVVIL
NLDGEVIEGERKPSSELDMHLIYYRNREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLMAGANNIKMAFTIAEEIEFCA
QIYYQTKSVGEPKLLPEDEMENLSKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttactgcaaaaagaaagagaagaagttgtagcgtacggaaagaaaatgatttctagt
ggtttaacaaaggggactggcggtaatattagtatttttaatcgtgaacaaggtcttgtt
gcaattagcccaagtggtctagattattatgaaacgacgcctgaagatgtagttatattg
aatttagatggtgaagtgatagaaggagagagaaaaccatcaagcgaattagatatgcac
cttatctattatagaaatcgtgaagatataaatgcgcttgtacatacacattctccttat
gcgaagacaatcgcatcattaggatgggaacttcctgctgtatcatatttaattgctttc
gcaggcccgaatgtacgctgtgcaccatatgaaacatttggtacgaagcaattagcagag
gcagctttcgagggcatgattgatcgccgtgcagttttacttgcgaaccatggtttaatg
gccggagcgaataatataaaaatggcgtttactattgcagaagaaattgagttttgtgct
caaatctattaccaaacgaaaagtgttggggaaccaaaattattgccagaagacgagatg
gagaatttgtcgaagaagtttgaagggtatggacagcagtaa

DBGET integrated database retrieval system