KEGG   Bacillus weihenstephanensis: BcerKBAB4_0643Help
Entry
BcerKBAB4_0643    CDS       T00642                                 

Definition
binding-protein-dependent transport system inner membrane protein
Orthology
K15599  
putative hydroxymethylpyrimidine transport system permease protein
Organism
bwe  Bacillus weihenstephanensis
Pathway
ABC transporters
Module
Putative hydroxymethylpyrimidine transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:bwe02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
740898..741653
Genome map
AA seq 251 aa AA seqDB search
MMNRLKELLPALILSGILLALWEVGARIVDEMYILPSPSAIVMKIWALKDILFTVHLPAT
LYVVLIGVVISIVLGVGLAMLMNASTWMERAFYPLLVASQTIPITALAPLFVLWFGYTIW
SKVVVTVLITFFPIAVNTYDGLRSTKKEWEELLVTYGATKKDVFLKLKLPSALPYFFSAL
KIAIPLSVIGAAIGEWLGAQAGLGYFSKRMMTQLDGAGVFAPIVLLSLLAIFFVILVSIL
EKKFISWRKHS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcgcttgaaggagttattacctgcccttatattaagtggaattttacttgct
ctgtgggaagtaggagcaagaattgtagatgagatgtacattttgccatcaccttctgca
attgtaatgaagatatgggcgctgaaagatatattatttacggttcatttacctgcaacg
ttatacgtcgttttaataggcgttgttatttctatcgtactgggcgtagggctagcaatg
ttaatgaatgcgagtacgtggatggaaagagcattttatccgttattagttgcttcacaa
acaatcccgatcactgcgcttgcaccgctcttcgttttatggtttggatataccatctgg
agtaaggttgttgttaccgttttaattacgtttttcccaattgcggtcaatacgtatgat
ggactgcgcagtacgaaaaaagaatgggaggagctattagttacatatggtgcaacgaaa
aaagatgtttttctaaagctaaagttgccatctgctcttccttattttttttcagcgtta
aaaattgcgataccacttagcgttattggggcagcgattggtgaatggctcggtgcacaa
gctgggcttggatatttcagtaaaagaatgatgacgcagttagacggagctggtgtattt
gcaccaattgtattgttatcattattagctattttcttcgtcatacttgtttcgatatta
gaaaagaaatttattagttggaggaaacattcatga

DBGET integrated database retrieval system