KEGG   Bacillus weihenstephanensis KBAB4: BcerKBAB4_1032Help
Entry
BcerKBAB4_1032    CDS       T00642                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bwe  Bacillus weihenstephanensis KBAB4
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BcerKBAB4_1032
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BcerKBAB4_1032
   00630 Glyoxylate and dicarboxylate metabolism
    BcerKBAB4_1032
Enzymes [BR:bwe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BcerKBAB4_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1111035..1112624
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLAGEMLPAYNEILTPEALSFLKELHENFNERRTELLKKRVEKQKRIDAGEF
PTFLEETKHIREGDWTIAQLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNA
PTWRNAVEGQINLRDASKGTISHKNENGKEYRLNSKTAVLIVRPRGWHLEEKHMQVDGKN
MSGSLVDFGLYFFHNAKTLLAKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTI
KATVLIETIHASFEMDEILYELRDHSAGLNCGRWDYIFSFLKSFRNHNEFLLPDRAQVTM
TAPFMRAYSLKVIQTCHRRNAPAIGGMAAQIPIKNDPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREGIRVTEKDLLEVPMGTITEGGLRTNINV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLSDGRNITFKLMEELK
EEELAKIEREIGKEAFNKGRFEEATKLFTNLVRNNEFMPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacactggccggagaaatgttaccagcgtacaacgaa
atattgacacctgaggcgcttagttttttaaaggaactgcatgaaaatttcaatgaacgc
cgcacggaacttttaaaaaagcgtgtggagaaacaaaaaagaattgatgcaggggagttt
cctacgtttttagaagaaacaaagcatatacgtgaaggggattggacaattgcccagctt
ccgaaagatttagaggatcgccgcgtggagattactgggccggtggatagaaagatggtc
attaacgctttaaattcaggagcacatctttttatggcagactttgaagattcgaatgca
ccaacttggagaaatgctgtcgaaggtcaaattaacttacgagatgcgagtaagggaacg
atttcacataaaaatgaaaacggaaaagaatatcgtttaaatagtaaaacagctgtatta
attgtgcgtccgagagggtggcatttagaagaaaaacatatgcaagttgacggcaagaac
atgtctggcagtttagtagattttggtttgtactttttccataatgcgaagacgctttta
gcaaaaggaagtggcccgtacttttacttaccgaaaatggaaagttacttagaggcaaga
ttatggaatgacgttttcgtattcgctcaaaagtatatcggtattccgaacggaacgatt
aaagcgactgtgttaatagaaacgattcacgcttcatttgaaatggatgaaattttgtat
gaactaagagatcattctgctggtttaaactgcggacgatgggattatatatttagtttc
ttaaagagcttccgtaatcataatgaatttttacttccggatagagcgcaagtcacgatg
acagcgccgtttatgcgcgcgtattctttgaaagttattcaaacgtgtcatcgtcgtaat
gcgccagcaatcggagggatggcggcgcaaatcccaattaaaaatgatccagaagcaaat
gaggcagctttcgagaaagtgcgtgctgataaggagcgcgaagctttagacggtcatgat
gggacttgggttgcccacccgggacttgtaccggttgcaatggaagtatttaatcacata
atgaaaacgccaaatcaaatttttagaaagcgtgaaggaatacgtgtaacagaaaaggat
ttattagaagtaccgatgggaacgattacagaaggtggtcttcgcacgaatattaacgtc
ggtattcaatatattgcatcttggttaagcgggcggggagcagctccaatttataactta
atggaagatgcagcaacagcagaaatatcaagagcacaagtatggcagtggattcgtcat
gagggtggaaagctaagtgatggccgtaatatcacttttaaattaatggaagaattgaaa
gaagaagaactagcaaaaatagaaagagagattggtaaggaagcatttaataaggggaga
tttgaagaagctacaaaactgtttacaaaccttgttcgtaataacgagttcatgccgttt
ttaacattaccgggttatgaaattttataa

DBGET integrated database retrieval system