KEGG   Bacillus mycoides KBAB4: BcerKBAB4_1032Help
Entry
BcerKBAB4_1032    CDS       T00642                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00620  Pyruvate metabolism
bwe00630  Glyoxylate and dicarboxylate metabolism
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01120  Microbial metabolism in diverse environments
bwe01200  Carbon metabolism
Module
bwe_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BcerKBAB4_1032
   00630 Glyoxylate and dicarboxylate metabolism
    BcerKBAB4_1032
Enzymes [BR:bwe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BcerKBAB4_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI Cas_Cas02710
Motif
Other DBs
NCBI-ProteinID: ABY42282
JGI: BcerKBAB41032
UniProt: A9VIZ3
Position
1111035..1112624
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLAGEMLPAYNEILTPEALSFLKELHENFNERRTELLKKRVEKQKRIDAGEF
PTFLEETKHIREGDWTIAQLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNA
PTWRNAVEGQINLRDASKGTISHKNENGKEYRLNSKTAVLIVRPRGWHLEEKHMQVDGKN
MSGSLVDFGLYFFHNAKTLLAKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTI
KATVLIETIHASFEMDEILYELRDHSAGLNCGRWDYIFSFLKSFRNHNEFLLPDRAQVTM
TAPFMRAYSLKVIQTCHRRNAPAIGGMAAQIPIKNDPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREGIRVTEKDLLEVPMGTITEGGLRTNINV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLSDGRNITFKLMEELK
EEELAKIEREIGKEAFNKGRFEEATKLFTNLVRNNEFMPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacactggccggagaaatgttaccagcgtacaacgaa
atattgacacctgaggcgcttagttttttaaaggaactgcatgaaaatttcaatgaacgc
cgcacggaacttttaaaaaagcgtgtggagaaacaaaaaagaattgatgcaggggagttt
cctacgtttttagaagaaacaaagcatatacgtgaaggggattggacaattgcccagctt
ccgaaagatttagaggatcgccgcgtggagattactgggccggtggatagaaagatggtc
attaacgctttaaattcaggagcacatctttttatggcagactttgaagattcgaatgca
ccaacttggagaaatgctgtcgaaggtcaaattaacttacgagatgcgagtaagggaacg
atttcacataaaaatgaaaacggaaaagaatatcgtttaaatagtaaaacagctgtatta
attgtgcgtccgagagggtggcatttagaagaaaaacatatgcaagttgacggcaagaac
atgtctggcagtttagtagattttggtttgtactttttccataatgcgaagacgctttta
gcaaaaggaagtggcccgtacttttacttaccgaaaatggaaagttacttagaggcaaga
ttatggaatgacgttttcgtattcgctcaaaagtatatcggtattccgaacggaacgatt
aaagcgactgtgttaatagaaacgattcacgcttcatttgaaatggatgaaattttgtat
gaactaagagatcattctgctggtttaaactgcggacgatgggattatatatttagtttc
ttaaagagcttccgtaatcataatgaatttttacttccggatagagcgcaagtcacgatg
acagcgccgtttatgcgcgcgtattctttgaaagttattcaaacgtgtcatcgtcgtaat
gcgccagcaatcggagggatggcggcgcaaatcccaattaaaaatgatccagaagcaaat
gaggcagctttcgagaaagtgcgtgctgataaggagcgcgaagctttagacggtcatgat
gggacttgggttgcccacccgggacttgtaccggttgcaatggaagtatttaatcacata
atgaaaacgccaaatcaaatttttagaaagcgtgaaggaatacgtgtaacagaaaaggat
ttattagaagtaccgatgggaacgattacagaaggtggtcttcgcacgaatattaacgtc
ggtattcaatatattgcatcttggttaagcgggcggggagcagctccaatttataactta
atggaagatgcagcaacagcagaaatatcaagagcacaagtatggcagtggattcgtcat
gagggtggaaagctaagtgatggccgtaatatcacttttaaattaatggaagaattgaaa
gaagaagaactagcaaaaatagaaagagagattggtaaggaagcatttaataaggggaga
tttgaagaagctacaaaactgtttacaaaccttgttcgtaataacgagttcatgccgttt
ttaacattaccgggttatgaaattttataa

DBGET integrated database retrieval system