KEGG   Bacillus mycoides KBAB4: BcerKBAB4_1033Help
Entry
BcerKBAB4_1033    CDS       T00642                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00630  Glyoxylate and dicarboxylate metabolism
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01120  Microbial metabolism in diverse environments
bwe01200  Carbon metabolism
Module
bwe_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BcerKBAB4_1033
Enzymes [BR:bwe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BcerKBAB4_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABY42283
JGI: BcerKBAB41033
UniProt: A9VIZ4
Position
1112650..1113927
Genome map
AA seq 425 aa AA seqDB search
MKNERIDKLQESWELDTRWKGITRPYTAEDVIRLRGSIDIEHTLARCGAEKLWKSLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGNGDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
QEFITGERTPEGFYHTKAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIHKKY
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFKLARGY
KERGMAAYSELQQAEFAAEKDGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
EQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaattgataaattgcaggaaagctgggaattagatacgcgctggaaa
gggataacacgtccatatacagctgaagatgtaattcgtctgcgcggatcgattgatatt
gaacatacgttagcgcgctgcggtgcagagaagctttggaaatcacttcatacagaagat
tatattaatgcacttggggcattaacaggaaaccaagcgatgcaacaagtgaaggctgga
ttaaaagcaatttatttaagcggttggcaagtagcggcagatgcgaacctttctggacat
atgtatcctgaccaaagcttatacccagcgaacagtgtgccagctgttgtaaaacgaatt
aaccaaacacttcaacgtgctgatcaaattcagcatatggaaggtaacggtgatacggat
tatttcgtcccaattgtggcggatgctgaagctgggtttggtggacagttaaacgtattt
gaattaatgaaagggatgattgaagcgggtgcatctggcgtgcactttgaagaccaatta
tcttcagagaaaaaatgcgggcatttaggcggaaaagtattattaccgacgcaaacagcg
gtgcgtaatttaatttcggcacgtcttgctgcggatgtaatgggtgtaccaacaattatc
gtcgcaagaacagatgcagatgcggcagatttaattacgagcgatatcgatccagttgat
caagagtttattacaggtgaaagaacgccagaagggttttatcatacgaaagcaggtctt
gatcaagcaattgcacgtggtttagcgtatgcgccgtatgcagatctcgtttggtgtgaa
acgtcggagccaaatttagaagatgcaaaacgctttgcggacgcaattcataagaaatat
ccagggaagctacttgcttacaactgttccccttcttttaactggaaacaaaaattagat
gaaaaaacgattgcaagcttccaaaaagaaattgcatcgtacggttataaattccagttc
gtaacgcttgctggattccattcattaaattacggcatgtttaaattagcgcgtggttat
aaagagcgcggcatggcagcgtactctgaattacaacaagcagagttcgcagcagaaaaa
gatggttactctgcaacgcgccatcaacgcgaagtaggaacaggatactttgatgaagta
gcacaagtaattacaggcggtacttcatcaacgactgctttaaaaggatctacggaagaa
gagcagtttacgaaataa

DBGET integrated database retrieval system