KEGG   Bacillus mycoides KBAB4: BcerKBAB4_1056Help
Entry
BcerKBAB4_1056    CDS       T00642                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00250  Alanine, aspartate and glutamate metabolism
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BcerKBAB4_1056
Enzymes [BR:bwe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BcerKBAB4_1056
Peptidases [BR:bwe01002]
 Cysteine Peptidases
  Family C44
   BcerKBAB4_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 QueC
Motif
Other DBs
NCBI-ProteinID: ABY42306
JGI: BcerKBAB41056
UniProt: A9VJ17
Position
1133158..1135005
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVDYKRSLEGERGIVTKMAETLAKRGPDDNKVWIKGNVAFGHKRLIVVDPEGGK
QPMTCLKDETSYAICYNGELYNTEDIRKELLRRGYTFKGHSDTEVLLASYIEWKEECVDH
LNGIYAFAVWDEKNERVFIARDRLGVKPLFYKYDSGRLLFGSELKAILAHPDVKAEVTLE
GLSEIFGLGPSRTPGHGVYAGIQELRPGHAMTFSKDGLCIWRYWNVESKKHEDSFEETVE
KTRFLLQDAITRQLVSDVPLCTFLSGGVDSSAITAIAAKEYERSGKGQLHTYSVDYEDND
KYFKANAFQPNSDAPFINLMTETFQTIHHRCVISNEQLAQYLTEAVLVRDLPGMADIDSS
LLWFCREIKQDFVVGLSGECADEIFGGYPWFYREDDLQSSTFPWMRSTEAREQLLKKEWR
NKLNLQQYVQQRYEESIQEVPILEGESPLEAKRRQLFYLNMVWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYAWNIPWEMKMYKNREKGLLRKALEGLLPNDILYRKKSPYPKTHNP
HYTKAVTVWLQDLLTDKGSILHELFDKEQLSGLIQSGGSAFQKPWFGQLMTGPQLLAHLA
QIHVWFKEYGVNIKE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggattacaggatgggtggattataaacgctcattagaaggggaaaggggcatc
gtgacgaagatggcggaaacgctagcgaaacgcggtccagatgataataaagtttggatt
aaagggaacgtcgcatttgggcataaacggttaatcgttgtagatcctgaaggtggtaaa
caacccatgacttgtttaaaagacgaaacgagttatgcgatttgctataacggagagctc
tacaatacagaagatattcgcaaagagttattaagaagaggttatacatttaaagggcat
tccgatacagaagtactattggcatcttatattgaatggaaagaagaatgtgtcgatcat
ttaaacggtatatatgcgtttgcagtatgggatgagaaaaatgaacgagtctttattgcc
agagatcgattaggtgtaaaaccgcttttttataaatatgatagcggacgattattattt
ggttcagagttaaaagcgatactagcgcatccagatgtgaaggcggaagtaacgttagaa
gggttgtcagaaatatttggcctcggaccatctagaacgcctggtcacggtgtatatgct
ggtattcaagaactgcgtccgggtcatgcaatgacgttctcaaaagacggtttatgcata
tggagatattggaatgtagaaagtaaaaaacatgaagattcatttgaagaaacagtagag
aaaactcgttttttattacaagatgcgattacgagacaattagtttctgacgtaccacta
tgcacttttttatcaggaggtgtagattcaagtgctatcacagcaattgccgcgaaagag
tatgaaagatcagggaaaggtcaattgcacacgtattctgttgactatgaagataacgac
aaatattttaaagcgaatgcgtttcagccgaattcagatgcaccatttattaatttaatg
acagagacatttcaaacaattcatcatcgctgcgtcatttctaatgaacaactagcacag
tatttaacagaagcagtactcgttcgggatttgcctggtatggcagatattgattcttca
ttattatggttttgccgtgaaataaaacaagattttgtcgtcggtttatctggagaatgt
gcagatgaaatattcggcggttatccgtggttttatagagaagatgatttacaatcaagt
acatttccgtggatgcgttctacagaagcgcgtgaacaacttctgaagaaagaatggaga
aataaattaaatttacaacaatatgtacaacaacgctatgaagaatccattcaagaagtt
cctattttagagggagaaagcccattagaagcgaagagacgacaattattttatttaaac
atggtatggtttatgacaacattattagacagaaaagaccgtatgagtatgggggcaagc
ttagaagtacgcgttccatttgcggaccaccgacttgtcgaatatgcgtggaatattcct
tgggaaatgaaaatgtataaaaaccgcgaaaaaggtctattgcgtaaggctttagaagga
ttacttccaaatgatatattgtatagaaagaaaagtccgtatccgaaaacgcataacccg
cactatacgaaagcagtcacagtatggctccaagatttattaacggataaaggctcaatt
ttgcatgaattgttcgataaggagcaattgagcggattgatccagtctggcggcagtgca
tttcaaaaaccgtggtttggtcaattaatgactgggccgcagcttttagctcatttagcg
caaattcatgtttggtttaaagagtatggggtaaatattaaggaatag

DBGET integrated database retrieval system