KEGG   Bacillus mycoides KBAB4: BcerKBAB4_1123Help
Entry
BcerKBAB4_1123    CDS       T00642                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00521  Streptomycin biosynthesis
bwe00523  Polyketide sugar unit biosynthesis
bwe01130  Biosynthesis of antibiotics
Module
bwe_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BcerKBAB4_1123
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BcerKBAB4_1123
Enzymes [BR:bwe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BcerKBAB4_1123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABY42372
JGI: BcerKBAB41123
UniProt: A9VJT6
Position
1197441..1197986
Genome map
AA seq 181 aa AA seqDB search
MKVVEINFTDAKLLEPRLFEDERGFFTESYNKKMLESLGITHSFVQDNVSYSAHSGTIRG
LHFQKNPKAQTKLIQVMQGAIYDVIVDLRKDSPTFKKWRGYILSADNHRQLLVPKGFAHG
FCTLVPHTIVMYKVDEYYSADHDSGLLWEDKELSIPWPVTNPILSDKDRILPLLQEYEDS
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtagaaataaattttaccgatgcgaaattgttagaaccgagattgtttgaa
gacgagcgaggtttttttactgaaagttataataagaagatgctagaatcgttagggatt
acgcattcatttgtgcaagataacgtatcttattcagcgcattcggggacgattcgaggg
ctacactttcaaaaaaatccgaaagcacaaacgaaactcattcaagttatgcaaggtgca
atatatgatgttatcgttgatttgcgaaaagattcacctacatttaaaaagtggagaggt
tatattttaagtgcggataatcataggcaattattagtgccgaaaggatttgctcatggt
ttttgtacacttgtacctcatacaattgttatgtataaagtagatgagtattatagtgct
gatcacgattccggtttgctttgggaagataaagaattatcaattccatggccggtaaca
aatcctatcttgtccgataaggatcgaatattaccattacttcaggaatatgaagatagt
ttttaa

DBGET integrated database retrieval system