KEGG   Bacillus weihenstephanensis: BcerKBAB4_1147Help
Entry
BcerKBAB4_1147    CDS       T00642                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bwe  Bacillus weihenstephanensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bwe01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bwe00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1217027..1217788
Genome map
AA seq 253 aa AA seqDB search
MGTILDKIVEQKKVEVAELYETYSPVKEKRKTHSLVKALEQFTVIAEVKRASPSKGDINL
HVDVPKQVKTYEECGAGAVSVLTDGQFFKGSFHDLETARAESNIPLLCKDFIIDKIQIDR
AYEAGADLILLIVAALSKEKLNELYNYVLEKGLEAIVEVHDEQELEIAIRLNPHVIGINN
RNLKTFEVDLSQTEKLGKRLNEENLLWISESGIHSKEDIIRVKRAGAKGVLVGEALMTSS
SISNFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggggacgattttagacaaaattgtagagcaaaagaaagtggaagttgcggagttatat
gaaacatattcaccagtgaaagaaaaaaggaaaacacactcacttgtaaaagctttagaa
cagtttactgtaatagcagaggtaaagcgagcgtctccatcaaaaggcgatattaattta
cacgttgatgtgccaaaacaagtgaaaacatatgaagaatgcggtgctggagcagtttcg
gttttaacagacggtcaattttttaaagggtcgtttcacgacttagaaacggcaagagca
gaaagtaacattccgcttttatgtaaagattttataatcgataaaatccaaattgataga
gcgtatgaagcaggagcagatcttattttattaattgttgcagcattgtcaaaagagaaa
ttaaacgagctttataactacgtgctagaaaaaggattagaagcgattgttgaagttcat
gatgaacaggaattagaaattgcaatccgattaaatccgcacgttatcggtattaacaac
cgtaatttaaaaacatttgaagtagatttaagccaaactgaaaagctcggaaaacgactg
aatgaggaaaacctactttggattagtgaaagcggcattcattcaaaagaagatattatt
cgcgtcaaacgagctggtgcaaaaggtgtattagttggagaagcacttatgacatcatct
tctataagtaactttttcgaagactgtaaggtgaacatatga

DBGET integrated database retrieval system