KEGG   Bacillus weihenstephanensis KBAB4: BcerKBAB4_1149Help
Entry
BcerKBAB4_1149    CDS       T00642                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bwe  Bacillus weihenstephanensis KBAB4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BcerKBAB4_1149
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BcerKBAB4_1149
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BcerKBAB4_1149
Enzymes [BR:bwe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BcerKBAB4_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1218396..1219589
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMQDEAFQKELNHYLQTYVGRET
PLYFAENMTKYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALFGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGKETKKQYEALEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDEEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPQMKKDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggtcattacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatccgtattagaattagaagaagcatataaagaagcgatgcaa
gatgaagcgtttcaaaaggaattaaatcattatttacaaacgtatgttggaagagaaaca
ccgctttatttcgctgaaaatatgacgaagtattgcggcggagcaaaaatctatttgaaa
cgtgaagatttgaaccatacgggagctcataaaattaacaatacaatcggtcaggcactt
cttgcggtaagaatgggtaagaagaaagttgtcgctgaaacaggagcaggacaacacgga
gttgcaacagctactgtatgtgcacttttcggtttagaatgcgtcatcttcatgggagaa
gaagatgtgagacgacaaaaattaaacgtgtttcgaatggaattactcggagcaaaagta
gaaagcgttgcggcaggtagcggcacgttgaaagatgcggtaaacgaggcgcttcgttac
tgggtttcacatgtacacgatacgcactacattatgggatcagttctcgggccacatcca
ttcccgcaaattgttcgtgatttccaaagtgtaattgggaaagaaacgaaaaagcaatac
gaagcgttagaagggaaattaccagaagcagtcgttgcttgtattggcggtggtagtaat
gcaatgggaatgttttatccgttcgtacacgatgaagaagttgctctttacggtgttgaa
gcagctggaaaaggtgttcacacagaaaagcacgcagccactttaacgaaaggaagtgtc
ggtgttttacacggatcgatgatgtaccttctgcaaaatgaagaagggcaaattcaagaa
gcgcactctatttcggcagggctggattacccaggtgttgggccagaacatagcttgcta
aaagatattggccgcgtttcttatcattccattacagatgaagaagcgttagaagcattt
caattattaacgaaaaaagaagggattatcccggcattagaaagttcacatgctgttgca
tacgctttaaaactagcgccgcaaatgaagaaagacgaaggacttgtcatttgtttatcc
ggccgcggtgataaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system