KEGG   Bacillus weihenstephanensis KBAB4: BcerKBAB4_1150Help
Entry
BcerKBAB4_1150    CDS       T00642                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bwe  Bacillus weihenstephanensis KBAB4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BcerKBAB4_1150 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BcerKBAB4_1150 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BcerKBAB4_1150 (trpA)
Enzymes [BR:bwe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BcerKBAB4_1150 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1219593..1220369
Genome map
AA seq 258 aa AA seqDB search
MGVEKIIAAFENGKKAFIPYVMGGDGGLEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTLKGIFQALIEVRQEVQIPFVLMTYLNPVLAFGKERFIESCLEAGV
DGIIVPDLPYEEQDIIAPLLRVANIALIPLVTVTSPIERIEKITSESQGFVYAVTVAGVT
GVRQNFKDEIRSYLEKVKEHVHLPVVAGFGISTREQIEEMITICDGVVVGSKVIELLENE
KREEICELIHAVKETEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaattatagcagcgtttgaaaatggcaagaaagcatttattccgtat
gtaatgggcggagatggtggacttgaaaagttaaaagaaagaattcgttttcttgatgaa
gcaggagcaagcatcgttgaaattggtatcccattttcagatccagtcgcagacggtcca
actattcaaagggcaggaaaaagagcattagatagcggtgtaacattgaaaggtattttt
caagcattaatagaggtgaggcaagaagttcaaattccatttgtacttatgacatattta
aatccagtactcgcattcggaaaggaacgtttcattgagagctgtcttgaagcaggggtg
gacggtattatcgttccggacttaccgtatgaagaacaagacattattgcaccgctcctt
cgcgtggcgaatatcgctttaattccactcgttaccgtaacgagccctattgaacgaatc
gaaaaaattacgagtgaatcacaaggattcgtctacgccgttacagtagcgggcgtaacg
ggagtacgtcaaaactttaaagatgagattcgtagttacttagaaaaagtaaaagaacac
gtccacttaccagtagtcgcaggattcggtatttcaacacgagaacaaattgaagaaatg
attacaatatgtgacggcgttgtcgttggaagtaaagtcattgagctgttagaaaatgaa
aagcgagaagaaatttgtgagttaatacatgcagtaaaagaaacagaagaggcttaa

DBGET integrated database retrieval system