KEGG   Bacillus mycoides KBAB4: BcerKBAB4_1165Help
Entry
BcerKBAB4_1165    CDS       T00642                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00020  Citrate cycle (TCA cycle)
bwe00310  Lysine degradation
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01120  Microbial metabolism in diverse environments
bwe01130  Biosynthesis of antibiotics
bwe01200  Carbon metabolism
Module
bwe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bwe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BcerKBAB4_1165
  Amino acid metabolism
   00310 Lysine degradation
    BcerKBAB4_1165
Enzymes [BR:bwe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BcerKBAB4_1165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ABY42414
JGI: BcerKBAB41165
UniProt: A9VJX8
Position
complement(1235807..1237063)
Genome map
AA seq 418 aa AA seqDB search
MIEIKVPELAESISEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAAAAVSTPAPPAEQPKQETTEAPKAAAPSAEQNKALQGLPN
TNRPIASPAARKMARELGIDLNEVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKQSPAPVA
KTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMSAIMELRKERKDAFEKKH
DVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDAN
QLNFAEIESEIRNLGLKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILGM
HKIQVRPVAIDAERMENRPMMYLALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctatttcagaaggaactatttcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgagact
gacaaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgctactatcgcaattttagatgccaatggcgca
gcagctgcagtaagcacaccagcaccacctgctgagcaaccaaaacaagaaactactgaa
gcaccgaaagcagcagctccaagtgctgaacaaaataaagcgttgcaaggtttaccaaat
acaaatcgtcctatcgcatcaccagctgctcgcaaaatggctcgtgaattaggaatcgat
ttaaacgaagtacgtagcacagatccacttggacgtgtgagaccacatgatgtacaagct
cacgctgcagcgccaaaagaagcaccagctgctccaaaacaaagtccggctccagttgca
aaaactgaatttgaaaaaccagttgagcgtgtgaaaatgtcccgccgccgtcaaacaatt
gcaaaacgtcttgtagaagttcaacaaacatctgcaatgttaactacatttaacgaagtt
gatatgagtgcaatcatggaattacgtaaagaacgcaaagatgctttcgagaaaaaacat
gatgtacgtcttggctttatgtcattcttcacaaaagcagttgttgcagcattaaaacag
ttcccattattaaatgctgaaattcaaggcgatgagcttatcattaaaaaattctatgat
atcggtattgcagtagcagctccagatggattagttgttccagttgtacgcgatgctaac
caattgaacttcgctgaaattgaaagcgagattcgtaatttaggtctgaaagcacgcgat
aataaactttcattaaaagagctacaaggtggtacatttacgattacaaatggtggcgtg
ttcggttctctaatgtcaacaccaatcctaaatagtccacaagtaggtattctagggatg
cataaaatccaagtacgtccagttgcaattgatgcagagcgtatggaaaaccgtccaatg
atgtaccttgcactatcttacgatcaccgtattgttgatggtaaagaagcagttagcttc
cttgttgctgttaaagatatgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system