KEGG   Bacillus mycoides KBAB4: BcerKBAB4_1619Help
Entry
BcerKBAB4_1619    CDS       T00642                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00010  Glycolysis / Gluconeogenesis
bwe00260  Glycine, serine and threonine metabolism
bwe00680  Methane metabolism
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01120  Microbial metabolism in diverse environments
bwe01130  Biosynthesis of antibiotics
bwe01200  Carbon metabolism
bwe01230  Biosynthesis of amino acids
Module
bwe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bwe_M00002  Glycolysis, core module involving three-carbon compounds
bwe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BcerKBAB4_1619
  Energy metabolism
   00680 Methane metabolism
    BcerKBAB4_1619
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BcerKBAB4_1619
Enzymes [BR:bwe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BcerKBAB4_1619
Membrane trafficking [BR:bwe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BcerKBAB4_1619
Exosome [BR:bwe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BcerKBAB4_1619
  Exosomal proteins of melanoma cells
   BcerKBAB4_1619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABY42862
JGI: BcerKBAB41619
UniProt: A9VNK8
Position
1663496..1664071
Genome map
AA seq 191 aa AA seqDB search
MTTIYFVRHAHSTYTKEERERPLSDKGHIDADNVIHLLKEEHIDVVISSPYKRAIQTVQG
IENTYNLSIQLEEDLRERLLSKEPVTDFNDAIQKVWEDWTFAYEGGESNDVAQRRAVICM
QSILKKYKGKNIVIGTHGNIMVLLMNYFDSKYGFQFWKTLHMPDVYKLTFDNNCFSSAER
IQSTDYQINNL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgactacaatatatttcgttcgccacgctcactctacatatacaaaggaagaaagggaa
cgccccttatctgacaagggacacattgatgcagataatgtaatacatttattaaaagag
gaacatattgatgttgtgatctctagtccgtataaaagggcgattcaaaccgtgcaagga
attgagaatacatataatttatcaatacaactggaagaagatttacgggaaaggttatta
agtaaagagccagtaacagattttaacgatgctattcagaaggtatgggaagactggact
tttgcatacgaaggcggggaatcaaatgatgtagcgcaaagacgcgctgtaatatgtatg
caaagtatattaaaaaaatataaaggtaagaatattgtaataggtactcatgggaatatt
atggtattactaatgaattattttgattcgaaatatggttttcagttttggaaaaccctt
catatgcctgatgtgtataaattaacttttgataataattgtttcagttctgctgaaaga
atacagtctacagattatcagataaataatttgtaa

DBGET integrated database retrieval system