KEGG   Bacillus weihenstephanensis KBAB4: BcerKBAB4_1834Help
Entry
BcerKBAB4_1834    CDS       T00642                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bwe  Bacillus weihenstephanensis KBAB4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BcerKBAB4_1834
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BcerKBAB4_1834
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BcerKBAB4_1834
Enzymes [BR:bwe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BcerKBAB4_1834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1903955..1905013
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYVSYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGAEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQNAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEAPETIATAIRI
GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVIKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNKFDIASVSNDIEQIKDHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggactattaaaacagtatgtttcttatttaccagtgaatgaaaacacacct
gatgtcagcttaatggaagggaatacacctctgattccattattaaatatatcaaagcaa
ttaggaattcagttatacgggaaatatgaaggagcgaatccaacaggttcttttaaagac
cgtggcatggtaatggcagttgcaaaggcgaaagaagaaggggcagaggcaattatttgt
gcatctacaggtaatacatcggcatcagctgccgcatatgcggcacgcctcggaatgaaa
tgtattatcgtaataccagaaggaaagattgcgcatgggaaattagcgcaagcagttgct
tatggagcggagatcatttcaatagaagggaatttcgatgatgcacttaaggctgtaaga
aatattgctgcagaagagccgattacattagtaaactcagtaaatccttaccgaattgaa
gggcaaaaaacagcggcatttgaaatttgtgaccagttgcaaaacgcaccagatgttcta
gctatccctgttggaaatgctgggaatattacagcatattggaaagggttctgtgaatac
gagaaagaaaaaggctataagaagcccagaattcacggctttgaagcggaaggagcggcg
gcaattgtaaaaggacatgtcattgaggcacctgaaacgattgcaacagcgattcgtatt
ggtaacccagcgagttggtcgtatgcagtagaggctgccgagcagtctcatggtgaaata
gatatggtgtcagatgaagaaatattacatgcgtatagattgttagcaaaaactgaagga
gtttttgcagagccaggatcaaatgcttcattagcgggcgtcattaaacatgtgcaatct
ggaaaaatcaaaaagggagaaacggttgttgcagttttaactggaaacggtttgaaagat
cctgatatcgcaatttcttctaataaatttgatattgcaagtgtgtcaaatgatatagaa
caaattaaagatcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system