KEGG   Bacillus mycoides KBAB4: BcerKBAB4_1926Help
Entry
BcerKBAB4_1926    CDS       T00642                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00010  Glycolysis / Gluconeogenesis
bwe00260  Glycine, serine and threonine metabolism
bwe00680  Methane metabolism
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01120  Microbial metabolism in diverse environments
bwe01130  Biosynthesis of antibiotics
bwe01200  Carbon metabolism
bwe01230  Biosynthesis of amino acids
Module
bwe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bwe_M00002  Glycolysis, core module involving three-carbon compounds
bwe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BcerKBAB4_1926
  Energy metabolism
   00680 Methane metabolism
    BcerKBAB4_1926
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BcerKBAB4_1926
Enzymes [BR:bwe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BcerKBAB4_1926
Membrane trafficking [BR:bwe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BcerKBAB4_1926
Exosome [BR:bwe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BcerKBAB4_1926
  Exosomal proteins of melanoma cells
   BcerKBAB4_1926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF5317
Motif
Other DBs
NCBI-ProteinID: ABY43157
JGI: BcerKBAB41926
UniProt: A9VRX2
Position
1987260..1987850
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILNVHEGRADFELTEKGRQQVQRLVQKVKADFPPDFIWASTLKRAR
ETGETLAEGIGCPIQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYDRIAIVAHGGVINSILRAFFQMPISMDYYFKIGDTGISLIELTDK
QKTIHFINDTNHLEGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgtcacggtgaatcagaagcagatattttaaatgtacatgaa
ggtcgagctgactttgaattaacagaaaagggaagacagcaagtacaaagacttgtacag
aaagtgaaagcagatttcccgccagatttcatttgggcaagcacattaaaacgtgctcgc
gaaactggtgaaacattagcagaaggaattgggtgcccaattcaactagaagaagaatta
atggagtttaataatggggtacaagcagggttatcatttgaagaagcgaaaaaatatcca
gagccaaaatttcttcatgatcgttttgaaaacggggaatcatttattgaatttagaatg
agaatagaagggattttttctaaaatcgtgacagagaatacatatgaccgaattgcaatt
gttgcacacggtggtgtaataaatagtattttacgagcgtttttccaaatgccaattagc
atggactattattttaaaataggagatacgggaattagtttgattgaacttacggataaa
cagaaaactattcattttataaatgatacaaatcatttagagggaatgtaa

DBGET integrated database retrieval system