KEGG   Bacillus weihenstephanensis KBAB4: BcerKBAB4_1926Help
Entry
BcerKBAB4_1926    CDS       T00642                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bwe  Bacillus weihenstephanensis KBAB4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BcerKBAB4_1926
   01230 Biosynthesis of amino acids
    BcerKBAB4_1926
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BcerKBAB4_1926
  Energy metabolism
   00680 Methane metabolism
    BcerKBAB4_1926
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BcerKBAB4_1926
Enzymes [BR:bwe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BcerKBAB4_1926
Exosome [BR:bwe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BcerKBAB4_1926
  Exosomal proteins of melanoma cells
   BcerKBAB4_1926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1987260..1987850
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILNVHEGRADFELTEKGRQQVQRLVQKVKADFPPDFIWASTLKRAR
ETGETLAEGIGCPIQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYDRIAIVAHGGVINSILRAFFQMPISMDYYFKIGDTGISLIELTDK
QKTIHFINDTNHLEGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgtcacggtgaatcagaagcagatattttaaatgtacatgaa
ggtcgagctgactttgaattaacagaaaagggaagacagcaagtacaaagacttgtacag
aaagtgaaagcagatttcccgccagatttcatttgggcaagcacattaaaacgtgctcgc
gaaactggtgaaacattagcagaaggaattgggtgcccaattcaactagaagaagaatta
atggagtttaataatggggtacaagcagggttatcatttgaagaagcgaaaaaatatcca
gagccaaaatttcttcatgatcgttttgaaaacggggaatcatttattgaatttagaatg
agaatagaagggattttttctaaaatcgtgacagagaatacatatgaccgaattgcaatt
gttgcacacggtggtgtaataaatagtattttacgagcgtttttccaaatgccaattagc
atggactattattttaaaataggagatacgggaattagtttgattgaacttacggataaa
cagaaaactattcattttataaatgatacaaatcatttagagggaatgtaa

DBGET integrated database retrieval system