KEGG   Bacillus weihenstephanensis: BcerKBAB4_2062Help
Entry
BcerKBAB4_2062    CDS       T00642                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bwe  Bacillus weihenstephanensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BcerKBAB4_2062
   00670 One carbon pool by folate
    BcerKBAB4_2062
Enzymes [BR:bwe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BcerKBAB4_2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2124728..2125216
Genome map
AA seq 162 aa AA seqDB search
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA
FEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttcatttatggtcgcaatggacgagaatagagtaattggtaaagataataac
ttaccttggcgtttaccgagtgaattacagtatgtaaagaaaacgacgatgggtcaccca
cttattatggggagaaagaactatgaagcaattggtagaccattgcctggaagacgtaat
attattgtaacacgtaatgaagggtatcatgttgaaggttgtgaagtagcacattctgta
gaagaagtgtttgaactatgcaaaaatgaagaggaaatctttattttcggcggagcacaa
atttatgatctctttttaccttacgtagacaagttatatataacaaaaatccatcatgca
tttgaaggagatacattcttcccagaaatggatatgacaaattggaaagaagtttttgtt
gaaaaaggtttaacggatgaaaagaatccgtatacgtactattatcatgtatatgagaag
caacaataa

DBGET integrated database retrieval system