KEGG   Bacillus weihenstephanensis KBAB4: BcerKBAB4_2089Help
Entry
BcerKBAB4_2089    CDS       T00642                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bwe  Bacillus weihenstephanensis KBAB4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BcerKBAB4_2089
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BcerKBAB4_2089
  Lipid metabolism
   00071 Fatty acid degradation
    BcerKBAB4_2089
  Amino acid metabolism
   00350 Tyrosine metabolism
    BcerKBAB4_2089
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BcerKBAB4_2089
   00626 Naphthalene degradation
    BcerKBAB4_2089
Enzymes [BR:bwe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BcerKBAB4_2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2149167..2150204
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEVIEKELRPLHSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGVGIVTKIADDVTSLKIGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSDIKPGQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIVQEEFGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDKVQNVFEEMEQGRIQGRMVIDFKQHNCECK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtagttaataaaaatagcaaagcaaatattgaagttattgaaaaagaa
ttacgtccgttacactcgggtgaagcgctagtagatgtagagtattgtggagtttgccac
actgatttacacgttgcgaatcatgattttggaaacaccgatggccgcatccttggtcat
gagggtgtaggtattgttactaaaattgctgatgatgttacttcactaaagataggtgac
cgtgtaagtattgcatggatgttccaatcttgtggacggtgtgaatattgcgtaacgggg
agagaaacattctgccgtgaagtgaaaaatgctggttattcagtagatggtggtatggct
gaacaatgtattgttacagctgattatgcggtgaaggtaccagaaggattagatcctgct
caagcatcatcaattacatgtgcgggcgtaactacatataaagctataaaagtatcagac
attaaacctggtcaacctatcgtaatctatggttgtggtggattaggtaacctagctatt
caatatgctaaaaacgtatttggtgcaaaggtaattgcagtagatatcaatgacgacaaa
ttagccttagcaaaagaagttggtgctgatatgactatcaatccgatttctcaaggtcct
gctgataaaattgttcaagaggagtttggtggtgcttatgctgctgtagtaacagcagtt
tctaaagtagcattcaactcagcagttgatgcagtacgtgcttgcggtaaagtagttgcg
gtaggtttaccagtagaaactatggatttaaacattccacgacttgtattagacggaatt
gaagtagttggttctctagttggtactcgtaaggatctggaggaggcatttatgttcggc
gcagaaggaaaagtagtgccggttgttcaaacgtgttctctagataaagtacaaaatgta
ttcgaagaaatggaacaaggtagaattcaagggcgtatggtaatcgattttaaacagcat
aattgtgagtgtaaataa

DBGET integrated database retrieval system