KEGG   Bacillus weihenstephanensis KBAB4: BcerKBAB4_2293Help
Entry
BcerKBAB4_2293    CDS       T00642                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bwe  Bacillus weihenstephanensis KBAB4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BcerKBAB4_2293 (gpmA)
   01230 Biosynthesis of amino acids
    BcerKBAB4_2293 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BcerKBAB4_2293 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BcerKBAB4_2293 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BcerKBAB4_2293 (gpmA)
Enzymes [BR:bwe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BcerKBAB4_2293 (gpmA)
Exosome [BR:bwe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BcerKBAB4_2293 (gpmA)
  Exosomal proteins of melanoma cells
   BcerKBAB4_2293 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2355505..2356242
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSKNGLSEAREAGTILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMDLTWVPIHNSWKLNERHYGALQGLNKDETAKKYGDEQVHIWRRSIDVR
PPALTEDDPRYEANNPRYKTLKKDEFPLTECLEDTEKRVVDYWHSEIVPSLKSGEKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDEKLRPIRHYYLSMDGEVPEGEIP
KHISF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtactcattcgtcacggacaaagtttgtggaatcttgaaaatcgattt
acaggatggacagatgtggatttatcaaagaatggattaagtgaagcgagagaagcagga
acaatattaaaaaagaatggatatacatttgatgttgcgtatacctcggtactaaaacga
gcaattcgtacattatggattgtactgcatgaaatggatctcacttgggtccctatacat
aactcatggaagttgaatgaacgccattatggtgcactacaaggattgaataaagacgaa
actgcaaaaaaatatggagatgaacaagttcatatttggagaagaagtatagatgtgaga
ccgcctgcacttactgaagatgatcctcgatatgaggcgaacaatccaagatataaaacg
ttaaaaaaagatgaattcccattgactgaatgtttagaggatacggagaaaagagtagtt
gattattggcattcagaaattgtaccgtcattaaaaagtggtgagaaagtaattatttca
tcgcacggtaatacaattcgttcgctagtgaaatacttagacaacctttcaagtgatggt
gttgtttcattaaatattccaactagcattccgcttgtttatgagttagatgaaaaatta
cgtccgattcgtcattattacttaagtatggatggagaagtacctgaaggggaaattccg
aaacatatttctttttaa

DBGET integrated database retrieval system