KEGG   Bacillus mycoides KBAB4: BcerKBAB4_3082Help
Entry
BcerKBAB4_3082    CDS       T00642                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00900  Terpenoid backbone biosynthesis
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01130  Biosynthesis of antibiotics
Module
bwe_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BcerKBAB4_3082
Enzymes [BR:bwe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BcerKBAB4_3082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABY44262
JGI: BcerKBAB43082
UniProt: A9VLZ6
Position
3131341..3132498
Genome map
AA seq 385 aa AA seqDB search
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIDLLEKQIESFQPRIVSVATK
ELAHTLRSRISTNTKITYGTDGLIEVSTHPDTNLVLSSVVGVSGLLPTIEALKAKKDIAI
ANKETLVSAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIEKLIVTASGGAFRD
KTREEMKTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEAKWLFDIPYEKIDVMIHK
ESIIHSLVEFIDGSVMAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPNL
EKFPCLQYAFECGKIGGTTPAVLNAANEIANALFLKNEIAFFDIEKTIYNTVEAHHNVKD
PSLDDILEADQWARQYANQLLMKKS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaatatatatccattttaggttcaacaggatccattggtacatctgcattagat
gtcgtttcagctcatcctgaacattttaaaatcgtcggtttaaccgcaaattataatatc
gatcttctcgaaaaacaaatcgagtcgtttcagcctcgtattgtaagcgtagcgacaaaa
gaattagcgcacacattacgttctcgtatttcaacaaatacaaaaatcacatatggaact
gatggtttaattgaagtatctacccatcctgatacaaatcttgtattaagttcagttgtc
ggtgtttcaggtttactcccaacaattgaagcattaaaggcgaagaaagatatcgccatc
gctaacaaagaaactttagtttcagctggacatatcgtaaccgaactagcgaaacaaaac
ggatgccgcctaattccagtcgatagtgaacattcagctattttccaatgtttaaatggg
gaaaataataaggaaatcgaaaaattaattgttacagcttctggcggcgcttttcgtgat
aaaacacgtgaagaaatgaaaacattacaagcgaaggatgctttaaaacacccaaactgg
ttaatgggcgcaaaactaacgatagattctgccacgttaatgaataaagggtttgaagtg
atggaagctaagtggctattcgatattccttatgaaaaaattgatgttatgattcataaa
gaaagtatcattcactctttagtagagtttattgatggatcagtcatggcacagctcggt
gcccctgatatgaggatgccgattcaatatgcgtttcactaccctactcgactaccttca
tcctatgaaaaattaaatttattagaaattggtagtttgcattttgaaaaaccaaattta
gagaagttcccctgtctacaatatgcatttgaatgtggaaaaattggcggtacaactcca
gctgtattaaatgcagcgaacgaaattgcaaatgcactatttcttaaaaatgaaattgca
tttttcgatatcgaaaaaacaatttacaatacagttgaagctcatcataacgtaaaagat
ccttcactcgatgatatattagaagctgatcaatgggcacgccaatacgcaaatcaattg
ttaatgaaaaagagctaa

DBGET integrated database retrieval system