KEGG   Bacillus weihenstephanensis: BcerKBAB4_3496Help
Entry
BcerKBAB4_3496    CDS       T00642                                 

Definition
heavy metal translocating P-type ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
bwe  Bacillus weihenstephanensis
Brite
Enzymes [BR:bwe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     BcerKBAB4_3496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3546231..3548651)
Genome map
AA seq 806 aa AA seqDB search
MNEQKEANLQISGMTCAACANRIEKGLKKVEGVHDANVNFALEKTKIMYDPHKTNPQQFK
EKVESLGYGIVSDKAEFTVSEMTCAACANRVEKRLNKLEGVNGATVNFALESATVDFNPD
EINVNEMKSAITKLGYKLEVKSDEQDGSTDHRLQEIERQKKKFIISFILSFPLLWAMVSH
FSFTSFIYLPDMLMNPWVQLALATPVQFIIGGQFYVGAYKALRNKSANMDVLVALGTSAA
YFYSVYLSIRSIGSSEHMTDLYFETSAVLITLIILGKLFEARAKGRSSEAIKKLMGLQAK
TATVVRDGTEMKILIEEVVAGDVVYVKPGEKIPVDGEIVEGKSAIDESMLTGESIPVDKT
IGDVVIGSTMNKNGFLKVKATKVGRDTALAQIIKVVEEAQGSKAPIQRVADQISGIFVPV
VVVIAIITFAVWMIFVTPGDFGGALEKMIAVLVIACPCALGLATPTSIMAGSGRSAEYGI
LFKGGEHLEATHRLDTVILDKTGTVTNGKPVLTDVIVADGFHEEEILRLVGAAEKNSEHP
LAEAIVEGIKEKKIDIPSSETFEAIPGFGIESVVEGKQLLIGTRRLMKKFDIDIEEVSKS
MEELEREGKTAMLIAINKEYAGIVAVADTVKDTSKAAIARLKKMGLDVVMITGDNTQTAQ
AIAKQVGIDHVIAEVLPEGKAEEVKKLQAQGKKVAMVGDGINDAPALATADIGMAIGTGT
DVAMEAADITLIRGDLNSIADAIFMSKMTIRNIKQNLFWALAYNGLGIPIAALGFLAPWV
AGAAMAFSSVSVVLNALRLQRVKLKS
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaaaaagaggccaatctccaaatatcaggcatgacatgtgcagcctgtgca
aatagaattgaaaaaggcctgaaaaaagtagaaggtgttcatgatgcaaatgtaaatttt
gcacttgaaaaaacaaaaataatgtatgatccccataaaacaaatccacaacaatttaag
gaaaaagttgagtcgctaggatatggaattgtaagtgataaagctgagtttactgtttca
gagatgacatgcgcagcatgtgcgaatagagtagaaaagcgtttaaataagttagaaggt
gtgaacggagcgacagtaaatttcgctttggaatcagctacagtagattttaatcctgat
gaaattaatgtaaatgaaatgaagagtgcaatcacgaaattaggatataaattggaagtg
aaatcagatgagcaagatggatcaactgatcatcgcttacaagaaattgaacgacaaaag
aagaaatttatcatttcgtttattttatcattcccgttactgtgggcaatggtaagtcat
ttctcatttacatcatttatttatttacctgatatgcttatgaacccttgggtgcagcta
gctcttgcaactccagtacagtttataattggaggccagttttatgttggggcttataaa
gcgttacgtaataaaagtgcaaacatggatgttcttgtggcacttggaacgtccgcagct
tatttctatagtgtttatttaagtattaggtcgattggttcttcagaacatatgacagat
ttatattttgaaacgagtgcggtacttattactttaattattttaggtaaattatttgag
gcgagagcaaaagggcgttcatcagaagctattaaaaagttgatgggactacaagcgaaa
actgccacagttgtgcgagatggaacagagatgaaaattttaatcgaagaagtggtagct
ggtgatgttgtctatgttaaacctggtgaaaaaatcccagtagatggagaaattgtagaa
ggaaaatcagcgatagatgaatcgatgttaacaggcgagagtattccagttgataaaaca
attggggatgtagtaattggctctacaatgaataaaaatggatttttaaaagttaaagca
actaaggtaggaagagatactgcattagctcaaattattaaagtagtagaagaggctcaa
ggttcaaaagctcctattcaaagggtagcagatcaaatttcaggtattttcgtacctgtt
gtagttgtaattgctattattacatttgcggtgtggatgatatttgttacacctggtgat
tttggcggagcacttgagaaaatgatagcagtacttgttatcgcttgtccgtgtgcatta
ggtcttgcaacacctacatctattatggcgggatcaggaagatcagctgagtatggtatt
ttatttaaaggtggagagcatttagaagcaacgcaccgattagatacagttattctagat
aaaacaggtactgtgacaaacgggaagcctgttttaacagatgtaattgtagcagatgga
ttccatgaagaagaaatactacgtttagtaggtgcggcagaaaaaaattctgaacatcca
cttgcagaagcgattgtagaaggaattaaagaaaagaaaattgatatcccaagttcagaa
acgtttgaagcgattccaggattcggtatcgaatcagtcgtagaagggaaacaattatta
attggtacacgtcgattaatgaagaaattcgatattgatattgaagaagtttctaaatcg
atggaagagctagaacgagaaggaaaaacagcaatgcttattgcgatcaataaagaatat
gctggtatagtggccgttgcagatactgtaaaagatacttcaaaagcagctatcgcaaga
cttaagaaaatgggtctagacgttgttatgattacaggagataatacacaaactgctcag
gcaatcgctaagcaagttggtattgatcacgtaattgcagaagtattacctgaaggaaaa
gcagaagaagtgaaaaaacttcaagcgcaaggtaagaaagtagcaatggttggagatgga
ataaatgatgctcctgcacttgctacggcggatatcggtatggcaattggaacaggtacg
gatgtagctatggaagcggcagacattacgttaatccgtggtgatttaaatagtattgct
gatgcaatttttatgagtaaaatgacgattagaaatattaagcaaaatctattctgggcg
ttagcttataacggcctaggaattccaattgcggcgctcggtttcttagctccttgggtt
gcaggtgcagcaatggcatttagctctgtatcagtcgtattaaatgcattaagattacaa
agagttaaattgaaatcttaa

DBGET integrated database retrieval system