KEGG   Bacillus weihenstephanensis: BcerKBAB4_3655Help
Entry
BcerKBAB4_3655    CDS       T00642                                 

Definition
tRNA (uracil-5-)-methyltransferase Gid
Orthology
K04094  
methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
bwe  Bacillus weihenstephanensis
Brite
Enzymes [BR:bwe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase (FADH2-oxidizing)
     BcerKBAB4_3655
Transfer RNA biogenesis [BR:bwe03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    BcerKBAB4_3655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3705720..3707024)
Genome map
AA seq 434 aa AA seqDB search
MTTQVVNVIGAGLAGSEAAYQIAKRGVQVKLYEMRPVRQTPAHHTDKFAELVCSNSLRAN
TLTNAVGVIKEEMRLMDSVIIRAADECSVPAGGALAVDRHEFAAKVTEYVKNHPNVTVMN
EEITEIPEGPTVIATGPLTSPDLSAQLKKLTGEDYFYFYDAAAPIVEKDSIDMNKVYLKS
RYDKGEAAYLNCPMTEEEFDRFYEALIAAETVPLKEFEKEIFFEGCMPVEVMASRGRQTL
VFGPMKPVGLEDPKTGKTPYAVVQLRQDDAAGTLYNIVGFQTHLKWGPQKEVLQLIPGLE
NAEIVRYGVMHRNTFINSPNLLRPTYQYKQRDDLFFAGQMTGVEGYVESAASGLLAGINA
ARLVKGEEPVVLPPVTAMGSMANYITATNAKNFQPMNANFGLFTPLEKKIKKKQERNEAY
ATRALETIQNFVNI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacaagtagtaaacgtcattggcgcaggtcttgcaggaagcgaagcagcttac
caaattgcaaagcgtggtgtccaagtaaaattatatgaaatgagaccagtaaggcaaaca
ccagctcatcatacagataaatttgctgaattagtatgtagtaactcacttcgcgcaaac
acattgacaaatgctgttggtgttattaaagaagaaatgcgtctaatggattctgtcatt
attcgtgcagctgatgagtgctctgtaccagcaggaggtgctttagctgtagaccgtcat
gaattcgcggcgaaagtgactgaatatgtgaaaaatcatccgaacgtaactgtaatgaat
gaggaaatcactgaaattccagagggaccaactgttatcgcgacaggtccacttacgtct
ccggatctttctgcacaattaaaaaaactaacaggtgaagattatttttatttctatgat
gctgcagcgccaatcgttgagaaagacagcattgacatgaataaagtatatttaaaatcc
cgttatgataaaggtgaagcggcatatttaaactgtccaatgacagaagaagagtttgat
cgtttttatgaggctttaattgctgctgagacagtgcctttaaaagaatttgaaaaagaa
attttctttgaaggttgtatgccagtagaagttatggcaagtagaggaagacagacgtta
gtatttggaccgatgaagcctgttgggttagaagatccgaaaacagggaaaacaccgtat
gcggttgttcagttacgtcaagatgatgcagcaggaacattatataatattgtaggcttc
caaacacatttaaagtgggggccacaaaaagaagtgttacagctaattccaggactagaa
aacgcagagattgtacgttatggtgtaatgcatcgtaatacgtttattaattcgcctaat
ttacttcgtccaacatatcaatataaacaacgtgatgatttattcttcgctggtcaaatg
actggtgtagagggttatgttgaatcagcagcatcaggattattagcgggtattaacgct
gctcgacttgtaaaaggtgaagagccagttgtattaccacctgtaactgcaatgggaagt
atggcaaattatattactgcgacaaatgcgaaaaacttccagccaatgaatgcaaacttc
ggtttatttacaccgttagagaagaaaattaaaaagaaacaagagcgaaatgaagcatat
gctacacgcgctttggaaacaattcaaaattttgtaaatatttaa

DBGET integrated database retrieval system