KEGG   Bacillus mycoides KBAB4: BcerKBAB4_3659Help
Entry
BcerKBAB4_3659    CDS       T00642                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00020  Citrate cycle (TCA cycle)
bwe00640  Propanoate metabolism
bwe00660  C5-Branched dibasic acid metabolism
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01120  Microbial metabolism in diverse environments
bwe01130  Biosynthesis of antibiotics
bwe01200  Carbon metabolism
Module
bwe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bwe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BcerKBAB4_3659
   00640 Propanoate metabolism
    BcerKBAB4_3659
   00660 C5-Branched dibasic acid metabolism
    BcerKBAB4_3659
Enzymes [BR:bwe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BcerKBAB4_3659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABY44830
JGI: BcerKBAB43659
UniProt: A9VT74
Position
complement(3711176..3712336)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTEVCVVKAQIHAGGRGKAGGV
KVAKNLEEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQ
VVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKF
MMGLYSAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRNKDILELRDLEEEDS
KEIEASKYDLNYIPLDGNIGCMVNGAGLAMATMDIIKHYHGDPANFLDVGGGATAEKVTE
AFKIILSDKNVKGIFVNIFGGIMKCDVIAEGVIEATKQVGLELPLVVRLEGTNVELGKKI
LNESGLNIVAAESMADGAQKIVSLVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggtaaggcagtccttagaagctatggggttagcgttccg
aacgggaaggttgcatttacagtagaagaagctgtagaagcagcgaaagaattaggaacg
gaagtatgtgtagttaaagcgcaaattcacgctggtggacgcggcaaagctggcggtgta
aaagttgcgaaaaatttagaagaagttcgtacatatgcagaaagcattttaggaactaca
cttgtgacgcatcaaacaggtcctgaaggtaaggaagtaaaacgcttacttatcgaagaa
ggttgcgatattaaaaaagaatattatgtaggtcttgtattagatcgtgcaacttctcaa
gttgttttaatggcatctgaagaaggtggaacagaaattgaagaagtagcagaaaaaacg
cctgaaaaaatctttaaagaatatattgatccagcagtaggtttacaaggtttccaagcg
cgtagaatcgcgtttaacatcaatattccaaaagaacttgtaggacaagctgtgaagttt
atgatgggcttatacagtgcgtttatcgaaaaagattgctctatcgctgagattaatcca
cttgttacaacaggtgacggtaaagttatggcgttagatgcaaaattaaactttgattct
aatgcgttatatcgcaataaagacattttagaacttcgtgatcttgaagaagaagattca
aaagaaattgaagcttctaaatatgatttaaactacattcctttagatggaaatatcggt
tgtatggttaatggtgcaggtttagcaatggctacaatggatatcattaaacattaccat
ggtgacccggctaacttcttagatgttggtggcggcgcaacagctgaaaaagttacagaa
gcattcaaaattatcctttctgacaaaaatgtaaagggtatcttcgttaacatttttggt
ggcattatgaagtgtgatgttatcgcagaaggtgttattgaagcgacgaagcaggtaggt
cttgagttgcctttagttgtacgtcttgaaggtacaaacgtagagctaggaaagaaaatt
ttaaatgagtctggtttaaatattgttgcagcagaatctatggcagacggtgcacaaaaa
attgtttcactagtgggctaa

DBGET integrated database retrieval system