KEGG   Bacillus mycoides KBAB4: BcerKBAB4_3716Help
Entry
BcerKBAB4_3716    CDS       T00642                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00240  Pyrimidine metabolism
bwe00250  Alanine, aspartate and glutamate metabolism
bwe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BcerKBAB4_3716
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BcerKBAB4_3716
Enzymes [BR:bwe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BcerKBAB4_3716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2-Hacid_dh_C DUF2002
Motif
Other DBs
NCBI-ProteinID: ABY44885
JGI: BcerKBAB43716
UniProt: A9VTC9
Position
complement(3768134..3769048)
Genome map
AA seq 304 aa AA seqDB search
MSHLLTMSELSEQEISEILKDAEDFANGKERKTTEQTFVANLFFENSTRTRFSFEVAEKR
LGLEVLDFSADASSVQKGETLYDTIRTLESIGTKAVVIRHEQDRYFDELKDQVNIPILNA
GDGCGNHPTQCLLDLLTIKQEFGRFEGLKIAIVGDVRHSRVARSNAEALTKLGATIYFAS
PEEWKDEENTFGTYKSLDELVPEVDVMMLLRVQHERHDHYETDIMKEYHEQHGLTVEREK
RMKEGSIIMHPAPVNRDVEIASELVECERSRIFKQMENGVYVRMAVLKRALPNVLGGMKH
ELFV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagccatttgttaacgatgagtgaattatcggaacaagaaatttcagaaatcctaaaa
gacgcagaagatttcgcgaatggaaaagagagaaaaacgacagagcaaacatttgttgcg
aacttgttctttgagaatagtacgaggacgagatttagctttgaagttgctgagaagaga
ttaggacttgaagtattagacttttccgcagatgcatctagcgtacaaaaaggagaaact
ttatacgatacgataagaacactagaatcaatcggaacaaaagcggtagtcatccgccat
gagcaagatcgttacttcgatgaattaaaagatcaggtgaatatcccaatcttgaacgct
ggagatggatgtggaaatcatccaacgcaatgtctactcgatcttctaacaattaaacaa
gagtttggaagatttgaaggtttgaagattgcaatagttggggatgttcgtcatagccga
gtagcacgttctaatgcagaagcattaacgaaactgggcgcgacaatttactttgcaagc
ccagaagagtggaaagatgaagagaacacatttggaacgtacaagagtttagatgaactt
gttccagaagtggatgtgatgatgttacttcgtgtacaacatgagcgtcatgaccattat
gaaacagacattatgaaagagtatcacgagcaacatgggttaacagttgaaagagaaaaa
cgtatgaaagaaggaagcattattatgcatccagcccctgtaaaccgtgatgttgaaatt
gcgagtgaacttgtcgagtgtgaacgctcacgcatattcaagcaaatggaaaacggggtc
tacgtaagaatggctgtactaaaacgcgcattaccaaatgtattaggaggaatgaaacat
gaattatttgtttaa

DBGET integrated database retrieval system