KEGG   Bacillus mycoides KBAB4: BcerKBAB4_3797Help
Entry
BcerKBAB4_3797    CDS       T00642                                 

Definition
(GenBank) Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00010  Glycolysis / Gluconeogenesis
bwe00020  Citrate cycle (TCA cycle)
bwe00620  Pyruvate metabolism
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01120  Microbial metabolism in diverse environments
bwe01130  Biosynthesis of antibiotics
bwe01200  Carbon metabolism
Module
bwe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BcerKBAB4_3797
   00020 Citrate cycle (TCA cycle)
    BcerKBAB4_3797
   00620 Pyruvate metabolism
    BcerKBAB4_3797
Enzymes [BR:bwe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BcerKBAB4_3797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NUP50
Motif
Other DBs
NCBI-ProteinID: ABY44966
JGI: BcerKBAB43797
UniProt: A9VUD2
Position
complement(3844161..3845450)
Genome map
AA seq 429 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVL
VEEGTVAIVGDTLIKFDAPGYENLKFKGDDHDEAPKAEEAAVEAPAAETTPAATAEVVNE
RVIAMPSVRKYAREKGVDIHKVAGSGKNGRVVKTDIDAFANGGQTVAATEAPAAVEATPA
AAKEEAPKAQPIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHR
KKFKAVAADKGIKLTYLPYVVKALTSALREFPMLNTALDDASQEIVHKHYFNIGIAADTD
KGLLVPVVKDTDRKSIFTISNEINELAGKARDGRLAPTEMKGASCTITNIGSAGGQWFTP
VINHPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLN
DPQLLVMEA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactaccagatatcggtgaaggtatccacgaaggtgaaatcgta
aaatggtttattaaaccaggcgatgaagtaaatgaagatgatgtacttcttgaagtacaa
aatgataaagcagtagtagaaatcccttctcctgttaaaggtaaagtacttgaagtactt
gtagaagaaggaacagttgcaattgtaggagatacattaattaaatttgatgctcctgga
tacgaaaaccttaaatttaaaggtgacgatcatgatgaagctccaaaagctgaagaagca
gcagtagaagctccagcagcggaaactactccagcagcaactgcagaagtagtaaatgag
cgtgtaatcgctatgccatctgttcgtaaatatgctcgtgaaaaaggtgtagacattcat
aaagtagctggttctggtaagaacggccgtgttgtgaaaactgacatcgatgcatttgca
aatggtggacaaactgtagcagcaactgaggctccagcagcagtagaagctactccagca
gcagcgaaagaagaagcaccaaaagcacaaccaatcccagctggtgaatatccagaaact
cgtgagaaaatgagtggtatccgtaaagcgattgcgaaagcaatggttaactctaagcat
acagctcctcacgtaacattaatggatgaagtagatgtaacagaacttgttgctcaccgt
aagaagttcaaagctgttgcagctgacaaaggtattaaattaacttaccttccatacgtt
gtaaaagctttaacatctgcattacgtgaattcccaatgttgaatactgctttagacgat
gcttctcaagaaatcgttcataaacattacttcaacatcggtatcgcagctgatacagac
aaaggtctattagtaccagttgttaaagatacagatcgtaaatctatctttactatctct
aacgagatcaatgaacttgctggtaaagcacgtgatggtcgtttagctccaactgaaatg
aaaggtgcttcttgcacaattacaaacattggttctgcaggtggacaatggttcactcca
gttatcaatcacccagaagtagcaatccttggtatcggccgtatcgctgagaaaccagtt
gtgaaaaacggtgaaatcgttgcagctccagtattagcattatctctaagctttgaccat
cgtttaattgacggcgcaactgctcaaaaagcattaaaccaaattaaacgtctattgaat
gacccacaattattagtaatggaggcgtaa

DBGET integrated database retrieval system