KEGG   Bacillus mycoides KBAB4: BcerKBAB4_3868Help
Entry
BcerKBAB4_3868    CDS       T00642                                 

Definition
(GenBank) Acireductone dioxygenase ARD
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00270  Cysteine and methionine metabolism
bwe01100  Metabolic pathways
Module
bwe_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BcerKBAB4_3868
Enzymes [BR:bwe01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BcerKBAB4_3868
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BcerKBAB4_3868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding Cupin_3 DUF3418
Motif
Other DBs
NCBI-ProteinID: ABY45036
JGI: BcerKBAB43868
UniProt: A9VFE2
Position
3911220..3911732
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEENTRIENEVEVSNFLQGEDVLYEKWNISKLPTHLKENYSLTDENKAEILTLF
SKEIADVSERRGYKAYDVVSLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGRFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgtattcatgaggaaaatactcgtattgaaaatgaagtagaagtatca
aactttctacaaggagaagatgttttatatgagaaatggaatatttctaaacttcctact
catttaaaagaaaattactccttaacagatgaaaacaaagctgaaatattaacgttgttt
tcaaaagaaattgctgatgtttcagagcgcagaggttataaagcatatgatgtggtttca
ctttcaaatagcacacctaaccttgacgagttattaattaatttccaaaaagaacaccat
catactgacgatgaagttcgctttattgtcagcggtcatggcatcttcgctattgaagga
aaagatggtcgattctttgacgttgaactcgagcctggtgatcttatatctgtgcctgaa
aatgcaagacactatttcaccttacaagatgatcgccaagttgtagctattcgtattttt
gttacaacagaaggttgggttccaatttattaa

DBGET integrated database retrieval system