KEGG   Bacillus mycoides KBAB4: BcerKBAB4_4116Help
Entry
BcerKBAB4_4116    CDS       T00642                                 

Definition
(GenBank) putative glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00010  Glycolysis / Gluconeogenesis
bwe00052  Galactose metabolism
bwe00500  Starch and sucrose metabolism
bwe00520  Amino sugar and nucleotide sugar metabolism
bwe00521  Streptomycin biosynthesis
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01120  Microbial metabolism in diverse environments
bwe01130  Biosynthesis of antibiotics
bwe01200  Carbon metabolism
Module
bwe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bwe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BcerKBAB4_4116
   00052 Galactose metabolism
    BcerKBAB4_4116
   00500 Starch and sucrose metabolism
    BcerKBAB4_4116
   00520 Amino sugar and nucleotide sugar metabolism
    BcerKBAB4_4116
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BcerKBAB4_4116
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BcerKBAB4_4116
Enzymes [BR:bwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BcerKBAB4_4116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: ABY45278
JGI: BcerKBAB44116
UniProt: A9VH46
Position
complement(4118686..4119669)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTNEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGISGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQQIQETDKESVLRSMLAEEGLITSKDVFEALGQGDELAGEV
VEKVASYLGLAVANLASTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IAILGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtgtatggtgaaattttacataagtgggaaatccctacgaatacaaatgaacaa
ggaaaacatattacacttgatgtagcgaaagctattgataaaaagttagaagaattaggt
gaattaaaaagcaagctaattggtattggtatgggagctcctggtcctgtacatgtggca
tctggaatgatttatgaagcggttaatttaggatggaaaaactatccgttaaaagattta
ctagaagtagaaacgggattacctgttgttattgataatgatgcaaacttagcggcgctt
ggtgaaatgtggaaaggtgctggtgaaggagcaaaagatttaatttgtatgacacttggc
actggtgttggtggtggtgttatcgccaatggtgagattgtacatggtataagcggtgct
gctggtgagattggacatattacagttgttacagagaacgcttttccatgtaattgcggg
aagtcgggttgtttagaaacggtagcctctgcaacaggtattgtacgtgttgctatgcaa
caaatacaagagacagataaagaaagtgttttacgttctatgttagcagaagaagggctt
attacatcaaaagatgtgtttgaagcgcttggacaaggtgacgaactagcaggtgaagta
gtggaaaaagtagcttcttatttaggattagctgtagcgaaccttgctagtacgttgaac
ccagagaaaatcgtaattggtggtggcgtatctaaagctggagacgcactattagagcca
attcaacgttatttcgagcaatatgctttctctcgtgctgtaaagagcacaaagttagca
attgcaatacttggtaatgatgcaggtgtaattggaggagcgtggcttgtaaaaaagcac
aaatacgaggcgaagatgatataa

DBGET integrated database retrieval system