KEGG   Bacillus weihenstephanensis: BcerKBAB4_4116Help
Entry
BcerKBAB4_4116    CDS       T00642                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bwe  Bacillus weihenstephanensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BcerKBAB4_4116
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BcerKBAB4_4116
   00052 Galactose metabolism
    BcerKBAB4_4116
   00500 Starch and sucrose metabolism
    BcerKBAB4_4116
   00520 Amino sugar and nucleotide sugar metabolism
    BcerKBAB4_4116
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BcerKBAB4_4116
   00524 Butirosin and neomycin biosynthesis
    BcerKBAB4_4116
Enzymes [BR:bwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BcerKBAB4_4116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4118686..4119669)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTNEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGISGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQQIQETDKESVLRSMLAEEGLITSKDVFEALGQGDELAGEV
VEKVASYLGLAVANLASTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IAILGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtgtatggtgaaattttacataagtgggaaatccctacgaatacaaatgaacaa
ggaaaacatattacacttgatgtagcgaaagctattgataaaaagttagaagaattaggt
gaattaaaaagcaagctaattggtattggtatgggagctcctggtcctgtacatgtggca
tctggaatgatttatgaagcggttaatttaggatggaaaaactatccgttaaaagattta
ctagaagtagaaacgggattacctgttgttattgataatgatgcaaacttagcggcgctt
ggtgaaatgtggaaaggtgctggtgaaggagcaaaagatttaatttgtatgacacttggc
actggtgttggtggtggtgttatcgccaatggtgagattgtacatggtataagcggtgct
gctggtgagattggacatattacagttgttacagagaacgcttttccatgtaattgcggg
aagtcgggttgtttagaaacggtagcctctgcaacaggtattgtacgtgttgctatgcaa
caaatacaagagacagataaagaaagtgttttacgttctatgttagcagaagaagggctt
attacatcaaaagatgtgtttgaagcgcttggacaaggtgacgaactagcaggtgaagta
gtggaaaaagtagcttcttatttaggattagctgtagcgaaccttgctagtacgttgaac
ccagagaaaatcgtaattggtggtggcgtatctaaagctggagacgcactattagagcca
attcaacgttatttcgagcaatatgctttctctcgtgctgtaaagagcacaaagttagca
attgcaatacttggtaatgatgcaggtgtaattggaggagcgtggcttgtaaaaaagcac
aaatacgaggcgaagatgatataa

DBGET integrated database retrieval system