KEGG   Bacillus weihenstephanensis: BcerKBAB4_4241Help
Entry
BcerKBAB4_4241    CDS       T00642                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bwe  Bacillus weihenstephanensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bwe03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4234557..4236893)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYLVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPDALSGVVNKQKAQEIYETIIEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYKLIEEVDGIGFGRADDIGRAIGITGNHDDRVRAGCFYTLENIS
LQLGHVYMEKGQLVRETMSLLNNQEGRVTEEDIVGCVEMMQSEGKVIIEEERVYLASLFY
SEKGVVKSIRRLMNQEETPAFPEAEVLKTLGEIEEQLKVQYAPLQQEAVQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGVSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKDGTLPPDLAQNKK
DRSFISCAGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQEVFNPK
KEKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYYRMLRRNLIYTGITRSKKF
LIICGEEAAFQSGVNRLDDAMRQTTLAGRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagaaaaaaaatttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgaaacgaatgaaacatacgacgaaaaaaaagtaatgataaacggtcattttccccgt
atgcatgaagatgaagtgtttacattaacaggtcattttaaagaccacccaaagtatgga
aaacaatatttagttgaaacgtttaaaaaagaactgccacaaacaaaagcaggtatggtg
caatatttagcgagcgatttatttaaagggattggaaagcgtacagccgaaaaaatcgtg
gaccatcttggtgagcatgcgatttctaaaattatggatgatccggatgcgttaagtggt
gttgtaaacaagcaaaaagcgcaggaaatatatgagacgattattgagcatcaagggctc
gagaaagtgatgagttttttaaatggttacggttttggaacaaaactttctattaaaatt
tatcagcaatataaagagatgacattagaagtgattcgtaataatccgtataaacttatt
gaagaagtggacggaattggatttggaagagcagatgatatagggcgtgcaatcggaata
acgggcaatcacgacgaccgtgtacgtgcagggtgtttttatacgttagagaatatttca
ttacaactcggtcacgtgtatatggaaaaaggtcagcttgtaagagaaacgatgtcactt
ttaaataatcaagaaggtagagtgactgaggaagatattgtaggctgcgttgaaatgatg
caaagcgaagggaaagtcattatagaagaagagcgagtgtatttagcttctttattctat
tctgagaaaggcgttgtaaagtcaattcgtcgtcttatgaatcaagaagaaacccctgca
ttccctgaagcagaagtgttaaaaacgttaggagaaattgaagaacagctaaaggtacag
tatgcgccgcttcagcaagaagcagttcaaactgcacttcataagccgatgatgttatta
acaggtggaccagggacggggaaaacaacagttattaaaggaattgttgaaatgtatgcg
tcacttcacggagtatcattaaacccgaatgaatatagtgatgataatccatttccaata
ttattaacggccccaactggaagagcggcgaagcgcatgagtgaatcgacaggacttcca
gcttgcacaattcatcgtctgcttggatggacgccagaaggatcttttcagcgcaatgaa
acagaccctgtacaagggaagctccttattattgatgagttttcgatggtagatatttgg
cttgcaaatcagctattcaagtcacttccgacaaatattcaagttatcgttgtaggtgat
gaagatcagttgccatctgtaggacctggacaagtgttaaaagatttattgaatgcaggt
gcggttccaacggtcaagcttacagaaatttatcgtcaagcggaagggtcatctgttatt
caacttgcccatgcgataaaggacggaacacttccgccagatttagcacaaaataaaaaa
gatcgttcatttatcagctgtgcaggtgctcaaattgttgaggttgttaaaaaggtttgt
gaaaatgctaagacaaaaggctttagtgcaagagatgtacaagtgttggcaccaatgtac
cgcggaccagcaggtattaatgtgttaaatgaagctcttcaagaagtgtttaatccgaaa
aaagaaaagagtaaagaaattgcctacggtgacgttgtataccgcagaggtgataaagta
cttcaattagtcaatcagccggaaagccaagtgtttaatggtgatattggagaaattgtt
tcagtattttatgcgaaagaaaatgtagagcaacaagatatgattatcgtttcatttgat
ggaattgaagtaacatatacaaagccggatttaaatcaaattacgcatgcctattgctgc
tcgattcataaatcacaaggtagtgaattcccaatagttattatgccaattgtaaagagc
tactaccgtatgttacgtcgtaatttaatttacacgggtattacaaggagtaagaaattc
cttattatttgcggggaggaagcagcgtttcaatccggtgtaaatcgccttgatgatgca
atgcgtcaaacgactttagctggccgattgcaagaatcacaaggagaagtgcagatggtg
acggttaatggtgaagaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system