KEGG   Bacillus mycoides KBAB4: BcerKBAB4_4241Help
Entry
BcerKBAB4_4241    CDS       T00642                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BcerKBAB4_4241
Enzymes [BR:bwe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BcerKBAB4_4241
DNA repair and recombination proteins [BR:bwe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BcerKBAB4_4241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 AAA_11 UvrD_C UvrD-helicase AAA AAA_12 T2SSE AAA_22 HHH_5 AAA_16 NTPase_1 AAA_29 Zeta_toxin AAA_18 AAA_28 TsaE AAA_17 DUF4926 GNAT_acetyltr_2
Motif
Other DBs
NCBI-ProteinID: ABY45400
JGI: BcerKBAB44241
UniProt: A9VIM0
Position
complement(4234557..4236893)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYLVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPDALSGVVNKQKAQEIYETIIEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYKLIEEVDGIGFGRADDIGRAIGITGNHDDRVRAGCFYTLENIS
LQLGHVYMEKGQLVRETMSLLNNQEGRVTEEDIVGCVEMMQSEGKVIIEEERVYLASLFY
SEKGVVKSIRRLMNQEETPAFPEAEVLKTLGEIEEQLKVQYAPLQQEAVQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGVSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKDGTLPPDLAQNKK
DRSFISCAGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQEVFNPK
KEKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYYRMLRRNLIYTGITRSKKF
LIICGEEAAFQSGVNRLDDAMRQTTLAGRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagaaaaaaaatttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgaaacgaatgaaacatacgacgaaaaaaaagtaatgataaacggtcattttccccgt
atgcatgaagatgaagtgtttacattaacaggtcattttaaagaccacccaaagtatgga
aaacaatatttagttgaaacgtttaaaaaagaactgccacaaacaaaagcaggtatggtg
caatatttagcgagcgatttatttaaagggattggaaagcgtacagccgaaaaaatcgtg
gaccatcttggtgagcatgcgatttctaaaattatggatgatccggatgcgttaagtggt
gttgtaaacaagcaaaaagcgcaggaaatatatgagacgattattgagcatcaagggctc
gagaaagtgatgagttttttaaatggttacggttttggaacaaaactttctattaaaatt
tatcagcaatataaagagatgacattagaagtgattcgtaataatccgtataaacttatt
gaagaagtggacggaattggatttggaagagcagatgatatagggcgtgcaatcggaata
acgggcaatcacgacgaccgtgtacgtgcagggtgtttttatacgttagagaatatttca
ttacaactcggtcacgtgtatatggaaaaaggtcagcttgtaagagaaacgatgtcactt
ttaaataatcaagaaggtagagtgactgaggaagatattgtaggctgcgttgaaatgatg
caaagcgaagggaaagtcattatagaagaagagcgagtgtatttagcttctttattctat
tctgagaaaggcgttgtaaagtcaattcgtcgtcttatgaatcaagaagaaacccctgca
ttccctgaagcagaagtgttaaaaacgttaggagaaattgaagaacagctaaaggtacag
tatgcgccgcttcagcaagaagcagttcaaactgcacttcataagccgatgatgttatta
acaggtggaccagggacggggaaaacaacagttattaaaggaattgttgaaatgtatgcg
tcacttcacggagtatcattaaacccgaatgaatatagtgatgataatccatttccaata
ttattaacggccccaactggaagagcggcgaagcgcatgagtgaatcgacaggacttcca
gcttgcacaattcatcgtctgcttggatggacgccagaaggatcttttcagcgcaatgaa
acagaccctgtacaagggaagctccttattattgatgagttttcgatggtagatatttgg
cttgcaaatcagctattcaagtcacttccgacaaatattcaagttatcgttgtaggtgat
gaagatcagttgccatctgtaggacctggacaagtgttaaaagatttattgaatgcaggt
gcggttccaacggtcaagcttacagaaatttatcgtcaagcggaagggtcatctgttatt
caacttgcccatgcgataaaggacggaacacttccgccagatttagcacaaaataaaaaa
gatcgttcatttatcagctgtgcaggtgctcaaattgttgaggttgttaaaaaggtttgt
gaaaatgctaagacaaaaggctttagtgcaagagatgtacaagtgttggcaccaatgtac
cgcggaccagcaggtattaatgtgttaaatgaagctcttcaagaagtgtttaatccgaaa
aaagaaaagagtaaagaaattgcctacggtgacgttgtataccgcagaggtgataaagta
cttcaattagtcaatcagccggaaagccaagtgtttaatggtgatattggagaaattgtt
tcagtattttatgcgaaagaaaatgtagagcaacaagatatgattatcgtttcatttgat
ggaattgaagtaacatatacaaagccggatttaaatcaaattacgcatgcctattgctgc
tcgattcataaatcacaaggtagtgaattcccaatagttattatgccaattgtaaagagc
tactaccgtatgttacgtcgtaatttaatttacacgggtattacaaggagtaagaaattc
cttattatttgcggggaggaagcagcgtttcaatccggtgtaaatcgccttgatgatgca
atgcgtcaaacgactttagctggccgattgcaagaatcacaaggagaagtgcagatggtg
acggttaatggtgaagaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system