KEGG   Bacillus mycoides KBAB4: BcerKBAB4_4307Help
Entry
BcerKBAB4_4307    CDS       T00642                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00860  Porphyrin and chlorophyll metabolism
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BcerKBAB4_4307
Enzymes [BR:bwe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BcerKBAB4_4307
Exosome [BR:bwe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BcerKBAB4_4307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABY45466
JGI: BcerKBAB44307
UniProt: A9VIT6
Position
complement(4305907..4306896)
Genome map
AA seq 329 aa AA seqDB search
MNSLQFNRHRRLRQSGGMRALVRETFLHTEDFIYPIFVLEGENTRNEVPSMPGVYQMSLD
LLQAEMQEVVDLGIRSVIVFGLPAEKDEVGSSAYCEHGIVQRAIKQIKDEFPELVVVADT
CLCQFTSHGHCGVIEDGVILNDESLAALAKTAVSQAKAGADIIAPSNMMDGFVTAIRHAL
DENGFAHVPVMSYAVKYSSAFYGPFRDAAHGAPQFGDRKTYQMDPANRMEAFREAESDVM
EGADFLIVKPALSYLDIVRDVKNNFNLPVVAYNVSGEYSMIKAAAQNGWINEKEVVLEKL
ISMKRAGADLIITYHAKDAARWLQEGGAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaattctttacaatttaatcgtcatcgtcgtttaagacaaagcgggggcatgcgtgcg
cttgtacgtgaaacatttttacatacagaagattttatttaccctatttttgtattagaa
ggagaaaatactcgtaatgaagttccttctatgccaggcgtatatcaaatgtctttagat
ttattgcaagctgaaatgcaagaggtcgttgatttaggtattcgttctgttattgtattt
ggtttacctgctgaaaaggacgaagttggatcatcggcatattgcgagcatggaattgta
cagcgtgcaattaagcaaattaaagatgagttcccagagctagtagtagttgcagataca
tgtttatgtcaatttacaagccatggtcattgcggtgttattgaagatggcgttatttta
aatgatgagtctcttgcagctcttgcaaaaacagctgtaagtcaagcgaaagcaggggca
gacattattgcaccatctaacatgatggacggattcgtaacagcaattcgccatgcatta
gatgaaaatggtttcgcgcacgtaccagttatgtcgtacgctgtgaaatattcatcagca
ttttacggaccgttccgtgatgcagcacatggtgcaccgcagtttggtgaccgtaaaaca
tatcaaatggacccagcgaaccgtatggaagcattccgtgaagcagaatcagatgtaatg
gaaggggccgacttcttaattgtaaagccagctctttcttatctagatatcgttcgtgat
gtgaaaaataactttaacttaccagtcgttgcttataacgtaagtggtgaatattcgatg
attaaagcagcagcacaaaatggttggattaatgaaaaagaagttgtacttgagaaatta
attagcatgaaacgcgcaggagcagacttgattattacgtatcatgcaaaagatgcagca
agatggttacaagaaggaggcgctaaataa

DBGET integrated database retrieval system