KEGG   Bacillus weihenstephanensis: BcerKBAB4_4402Help
Entry
BcerKBAB4_4402    CDS       T00642                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bwe  Bacillus weihenstephanensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bwe00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4403730..4404815)
Genome map
AA seq 361 aa AA seqDB search
MIKLDETLTMLKELTDARGIAGNEREPREVMKKYIEPFADELSTDNLGSLVAKKVGEENG
PKIMVAGHLDEVGFMITQIDDKGFLRFQTVGGWWSQVMLAQRVTIVTRKGDVTGVIGSKP
PHILPPEARKKPVEIKDMFIDIGASSQEEAMEWGIRPGDQVVPYFEFQVMKNEKMLLAKA
WDNRIGCAIAIDILKQLKDEKHPNVVYGVGTVQEEVGLRGAKTSANYIKPDIAFAVDVGI
AGDTPGVTAKEAQSKMGDGPQIILYDASVIGHTGLRDFVVDVADELQIPYQYDSVAGGGT
DAGAIHISVNGIPSMAITIATRYIHSHAAMLHRDDYENAVKLIVEVIKRLDKEAVHNITF
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgataaaattagacgagacattgacaatgctaaaagaattaacagacgcacgcggtatt
gcgggtaacgagcgcgaaccacgtgaagtaatgaagaaatatattgagccgtttgcagat
gaactttctactgacaatttaggaagtttagttgcgaaaaaagttggggaagaaaacggc
ccgaaaattatggttgcaggtcatttagatgaagtcggctttatgattacgcaaattgat
gacaaaggcttccttcgtttccaaacggtgggtggctggtggtcgcaagttatgcttgca
cagcgcgtaacgattgtaacgcgtaaaggagatgtaacaggtgtaattggttcaaaacca
ccgcacattttacctccagaagctcgtaaaaagccagttgaaattaaagacatgttcatc
gatattggtgcttctagccaagaagaagcgatggagtggggcatccgaccaggggatcaa
gttgtaccgtacttcgaattccaagtgatgaagaatgaaaagatgttacttgcaaaagca
tgggataaccgaattggttgtgcaattgcaattgacatattaaaacaattaaaagatgaa
aagcatccaaacgttgtatacggcgttgggactgtacaagaagaagttggtcttcgtggt
gcgaaaacatctgcaaactatattaagccagatatcgcattcgcagtagatgtaggtatt
gctggtgatacaccaggtgtaacggcaaaagaagcacaaagtaaaatgggtgatggtccg
cagatcattctatatgatgcttctgttattggtcatacaggtttacgtgatttcgttgtt
gatgttgcggatgaattacaaattccatatcagtatgattctgtagcgggcgggggaacg
gacgcaggagcaattcacatttctgtaaatggtatcccatctatggcaattacgattgcg
acacgctacattcattctcatgcagcgatgttacatcgtgatgattatgaaaacgcagtg
aagttaattgtagaagttattaaacgtcttgataaagaggctgtacataacattacattt
aattaa

DBGET integrated database retrieval system