KEGG   Bacillus mycoides KBAB4: BcerKBAB4_4429Help
Entry
BcerKBAB4_4429    CDS       T00642                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00010  Glycolysis / Gluconeogenesis
bwe00030  Pentose phosphate pathway
bwe00051  Fructose and mannose metabolism
bwe00052  Galactose metabolism
bwe00680  Methane metabolism
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01120  Microbial metabolism in diverse environments
bwe01130  Biosynthesis of antibiotics
bwe01200  Carbon metabolism
bwe01230  Biosynthesis of amino acids
bwe03018  RNA degradation
Module
bwe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BcerKBAB4_4429
   00030 Pentose phosphate pathway
    BcerKBAB4_4429
   00051 Fructose and mannose metabolism
    BcerKBAB4_4429
   00052 Galactose metabolism
    BcerKBAB4_4429
  Energy metabolism
   00680 Methane metabolism
    BcerKBAB4_4429
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BcerKBAB4_4429
Enzymes [BR:bwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BcerKBAB4_4429
Protein phosphatases and associated proteins [BR:bwe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BcerKBAB4_4429
Messenger RNA biogenesis [BR:bwe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BcerKBAB4_4429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABY45588
JGI: BcerKBAB44429
UniProt: A9VJR1
Position
complement(4433545..4434504)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDI
IHRGGTKLYTARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLADGAETILIPEEKYDMEDVIARLKRGSERGKKHSIIVVAEGVGSAIDIGKHIEEATSF
DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLIAGNGGRCVGIQNNKLVDHDIIEAL
AQKHTIDKDMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtgtattaacaagtggtggagattcacctggtatgaatgctgccatt
cgtgcagttgttcgtaaagcgattttccatgatattgaagtatatggtatttaccatgga
tacgctggtttaatttctggtcatattgaaaaattagaacttggttctgttggcgatatt
atccaccgtggtggtacaaaattatatacagcaagatgtcctgagtttaaagacccagaa
gtacgactaaaaggaatcgagcaattaaagaaacatggtattgaaggacttgtcgttatt
ggtggagatggttcgtaccaaggcgcaaaaaaattaactgagcaaggattcccatgtgta
ggtgtaccaggtacaatcgacaatgatatccctggaacagacttcacaattggttttgat
acagctttaaacactgttattgatgcaattgataaaatccgtgatacagctacatctcat
gaacgtacatatgttatcgaagtaatgggacgtcacgctggagatatcgcattatgggct
ggtttagctgatggtgcagaaactatcttaattccagaagaaaagtatgacatggaagat
gttatcgctcgtctgaaacgcggtagtgaacgtggtaaaaagcacagtattatcgttgta
gctgagggtgttggaagtgcaattgacatcggtaagcacattgaagaagcaacaagcttt
gatactcgtgtaactgtattaggtcacgtacaacgtggtggatcaccaagtgcacaagac
cgtgtattagctagtcgtcttggcgcaagagcagttgaattattaattgctggtaatggc
ggacgttgtgttggtattcaaaataataaacttgttgatcatgacattatcgaagcgtta
gctcaaaagcatacaatcgataaagatatgtatcaattatctaaagaattatctatctaa

DBGET integrated database retrieval system