KEGG   Bacillus weihenstephanensis: BcerKBAB4_4429Help
Entry
BcerKBAB4_4429    CDS       T00642                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bwe  Bacillus weihenstephanensis KBAB4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BcerKBAB4_4429
   01230 Biosynthesis of amino acids
    BcerKBAB4_4429
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BcerKBAB4_4429
   00030 Pentose phosphate pathway
    BcerKBAB4_4429
   00051 Fructose and mannose metabolism
    BcerKBAB4_4429
   00052 Galactose metabolism
    BcerKBAB4_4429
  Energy metabolism
   00680 Methane metabolism
    BcerKBAB4_4429
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BcerKBAB4_4429
Enzymes [BR:bwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BcerKBAB4_4429
Protein phosphatases and associated proteins [BR:bwe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BcerKBAB4_4429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4433545..4434504)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDI
IHRGGTKLYTARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLADGAETILIPEEKYDMEDVIARLKRGSERGKKHSIIVVAEGVGSAIDIGKHIEEATSF
DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLIAGNGGRCVGIQNNKLVDHDIIEAL
AQKHTIDKDMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtgtattaacaagtggtggagattcacctggtatgaatgctgccatt
cgtgcagttgttcgtaaagcgattttccatgatattgaagtatatggtatttaccatgga
tacgctggtttaatttctggtcatattgaaaaattagaacttggttctgttggcgatatt
atccaccgtggtggtacaaaattatatacagcaagatgtcctgagtttaaagacccagaa
gtacgactaaaaggaatcgagcaattaaagaaacatggtattgaaggacttgtcgttatt
ggtggagatggttcgtaccaaggcgcaaaaaaattaactgagcaaggattcccatgtgta
ggtgtaccaggtacaatcgacaatgatatccctggaacagacttcacaattggttttgat
acagctttaaacactgttattgatgcaattgataaaatccgtgatacagctacatctcat
gaacgtacatatgttatcgaagtaatgggacgtcacgctggagatatcgcattatgggct
ggtttagctgatggtgcagaaactatcttaattccagaagaaaagtatgacatggaagat
gttatcgctcgtctgaaacgcggtagtgaacgtggtaaaaagcacagtattatcgttgta
gctgagggtgttggaagtgcaattgacatcggtaagcacattgaagaagcaacaagcttt
gatactcgtgtaactgtattaggtcacgtacaacgtggtggatcaccaagtgcacaagac
cgtgtattagctagtcgtcttggcgcaagagcagttgaattattaattgctggtaatggc
ggacgttgtgttggtattcaaaataataaacttgttgatcatgacattatcgaagcgtta
gctcaaaagcatacaatcgataaagatatgtatcaattatctaaagaattatctatctaa

DBGET integrated database retrieval system