KEGG   Bacillus weihenstephanensis KBAB4: BcerKBAB4_4493Help
Entry
BcerKBAB4_4493    CDS       T00642                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bwe  Bacillus weihenstephanensis KBAB4
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BcerKBAB4_4493
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BcerKBAB4_4493
   00620 Pyruvate metabolism
    BcerKBAB4_4493
   00640 Propanoate metabolism
    BcerKBAB4_4493
  Energy metabolism
   00680 Methane metabolism
    BcerKBAB4_4493
Enzymes [BR:bwe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BcerKBAB4_4493
Lipid biosynthesis proteins [BR:bwe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BcerKBAB4_4493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4488014..4489732)
Genome map
AA seq 572 aa AA seqDB search
MKVETLPVIKGENNLPNYEEAYANFNWEEVNKNFTWNETGRVNMAYEAIDKHAKSDRKNK
VALYYQDGSRKEKYTFKEMKDFSNKAGNVLKNYGDVEKGDRVFIFMPRSPELYFALLGAV
KLGAIVGPLFEAFMEGAVRDRLEDSEAKVLITTPELLERIPLNDLPALKTVFLVGDNAEE
GGKTVAFNPLFEQASKELHIEWLGREDGLILHYTSGSTGKPKGVLHAQNAMVQHYQTAKW
VLDLKEDDVYWCTADPGWVTGTAYGIFAPWLVGASNVILGGRFSPEAWYEALQDYGVTVW
YSAPTAFRMLMGAGQDAIKKYDLSQVRHVLSVGEPLNPEVIRWGMSAFGLRIHDTWWMTE
TGGQVICNYPCMEIRPGSMGKPIPGVKAAIVDNEGNEVPPYTMGNLAIGKGWPSMMRAVW
NNPQKYDSYFMPGDWYVSGDSAYMDEDGYFWFQGRIDDVIMTSGERVGPFEVESKLIEHA
AVAEAGVIGIPDPVRGEIIKAFIALRVGYEPSDELKEEIRQFVKKGLAAHAAPRQIEFRD
KLPKTRSGKIMRRVLKAWELNLPTGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggaaacgcttcctgtcattaaaggagaaaataatttgccgaattatgaagag
gcatacgcgaattttaactgggaagaggttaataaaaattttacttggaatgaaacaggc
cgagtgaatatggcgtatgaggcaattgataagcatgcgaaatccgatcgaaagaataaa
gtagcactttattatcaagatggatcgcgaaaagagaaatatacgtttaaggaaatgaag
gatttttctaataaagcaggaaatgtcctgaaaaactatggcgatgttgagaaaggcgat
cgcgtttttatttttatgccgcgttccccagaattatatttcgcacttttaggtgcagtg
aaattaggggcaattgttggaccattatttgaagcatttatggaaggcgcagttcgcgat
cgtttagaagatagcgaagcgaaggtgttaattacaactcctgaattgttagagcgcata
ccattaaatgatttacctgctttaaaaacagtcttccttgttggagacaatgcagaagaa
ggcggtaaaactgtagcgttcaatcctttatttgaacaagcttcaaaagaattacatatc
gagtggttaggccgtgaagacggtttaattctacattacacatctggttctactggtaag
ccaaaaggcgtccttcatgctcaaaacgcaatggttcagcactatcaaacagcgaaatgg
gtattagatttaaaagaagatgatgtatattggtgtacagctgacccaggctgggtaact
ggaacagcttacggtatttttgcaccatggttagtgggagcatcaaatgttattttaggc
gggagatttagtccagaggcatggtatgaagcactgcaagattacggtgtaacagtttgg
tatagtgcaccgacagcgttccgtatgttaatgggagctggacaagacgcaattaaaaaa
tatgatttatcacaagtgcgtcacgtattaagtgttggtgagccattaaatccagaagta
attcgctggggtatgagcgcatttggacttcgtattcatgatacgtggtggatgacagaa
acaggtggacaagttatttgtaactatccttgtatggaaatccgtccaggttcaatgggg
aaaccaattccaggtgtgaaagcagcgattgttgataatgaaggaaatgaagtgcctcca
tacacaatggggaacttagcaattggtaaaggttggccatctatgatgcgtgcggtttgg
aataacccgcaaaaatatgattcttactttatgccgggagattggtacgtatcaggtgac
tctgcttatatggatgaagacggatacttctggttccaaggacgtattgacgatgtaatt
atgacgtcaggtgagcgcgttggtccatttgaagtagaaagtaaattaatcgagcacgct
gctgtagcagaagctggtgtaattggtattcctgatccagtacgcggagaaatcattaaa
gcatttatcgcgcttcgcgtgggatacgaaccatctgatgaattaaaagaagagattcgt
caatttgtaaagaaaggcctagcagctcatgcagcgccaagacaaattgaatttagagat
aaattaccgaaaacgagaagtggtaaaattatgcgccgcgtattaaaagcgtgggagcta
aacttaccaacaggtgacttatcaacgatggaagattaa

DBGET integrated database retrieval system