KEGG   Bacillus mycoides KBAB4: BcerKBAB4_4535Help
Entry
BcerKBAB4_4535    CDS       T00642                                 

Definition
(GenBank) dipeptidase, putative
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00300  Lysine biosynthesis
bwe01100  Metabolic pathways
bwe01120  Microbial metabolism in diverse environments
bwe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BcerKBAB4_4535
Enzymes [BR:bwe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BcerKBAB4_4535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABY45691
JGI: BcerKBAB44535
UniProt: A9VKL4
Position
complement(4524521..4525927)
Genome map
AA seq 468 aa AA seqDB search
MSTINWTEEVTKRKDDLIRDTQKFLQIKSVWEEESAKEGAPFGEGVEEALSFMLHKGEAE
GFTSKNLEGYAGHLEMGQGEELVGILCHVDVVPEGDGWTTPAYSADIRDGKIFARGAIDD
KGPTMAAYYAMKIVKELGLPLSKRVRMILGTDEESNWKCVDHYFKNEEMPTIGFAPDADF
PIINAEKGISDIQVVQSGGEEKEGTFKLISFESGRRLNMVPDFAEAVITGEDVNTLTVAY
EEYLQTAKKIGKAIVEGKTVTLQIKGISAHGSTPEKGENAGLLLVNFLTKVSLDGKGASF
ASFVTETFTGDIIGEKAGISYKDDISGPLTVNVGRLSYSQENGGNLGLNVRYPVTTNFEE
TIAKLKEYVGTHGFEVADYSNSRPHHVDKDHTLIRTLQRVYEEQTGEKAELLAIGGGTYA
RSLKAGVAFGPLFPGKEELAHQKDEYIEIEDLLKATAIYAQAIHELAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgattaattggacagaagaagttacaaaacgaaaagatgatttaattcgtgat
acacaaaaatttttacaaattaaaagtgtatgggaagaagaatctgcgaaagagggcgca
ccattcggtgaaggtgtagaagaagctttatctttcatgttacataaaggagaagcagaa
ggtttcacttctaaaaatttagaaggatatgcaggtcatcttgaaatgggacaaggagaa
gagttagtaggtattctttgtcacgttgatgttgtaccagaaggagacggctggacaact
cctgcgtatagtgcggatattcgcgatggaaagatttttgcacgtggtgcaattgatgat
aaagggccgacgatggcagcttattatgcgatgaaaatcgttaaagaattgggcttacct
ctttcaaaacgtgttcgtatgattttaggaacagatgaggaaagtaattggaagtgtgta
gatcattattttaaaaatgaagaaatgccaacaatcggttttgcgccggatgcagatttt
ccgattattaatgcggaaaaaggaatttctgacatacaagttgtgcaaagtggtggtgaa
gagaaagaaggcacatttaagcttatttcatttgagtcaggtcgtcgtttaaatatggtt
cctgattttgcagaagcagttattacaggagaagatgtaaatacacttacagtagcatat
gaagagtatttacaaactgctaaaaaaataggtaaagcaattgtagaaggaaagacggtg
acgttgcaaatcaaagggatttcagctcacggatctactccggaaaagggagaaaatgca
ggtttattattggtaaacttcttaacgaaagtttctcttgatggaaaaggggcttcattt
gcctcgtttgtaacagaaacatttacaggtgatattattggagaaaaagctggtatttct
tataaagacgatattagcgggccgttaacagtgaatgttggtcgcttgtcttactcgcaa
gaaaacggtggtaatttaggattaaatgtacgctatccagttacaactaactttgaagaa
acgattgcaaagttaaaagaatatgttggtactcatggatttgaagtagcggattattct
aactctcgcccgcatcacgttgacaaagatcatacgttaattcgtactttgcaacgtgta
tatgaagaacaaactggtgaaaaagctgaattgttagcaattggcggtggtacttatgct
cgttcattgaaagctggcgttgcatttggcccgttattcccaggaaaagaagaacttgcg
catcaaaaagatgagtacattgaaattgaagatttattaaaagcgacagcgatttacgct
caagcaattcatgaattagcgaaataa

DBGET integrated database retrieval system