KEGG   Bacillus weihenstephanensis: BcerKBAB4_4586Help
Entry
BcerKBAB4_4586    CDS       T00642                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bwe  Bacillus weihenstephanensis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BcerKBAB4_4586
Enzymes [BR:bwe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BcerKBAB4_4586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4571595..4572398)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVVVIVHGAMEYHGRYEAIAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFIFGHSMGGLIVIRMMQETKREDVDGIILSSPCLGVLT
GPSAPLRAASKILNVVAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIGDFPDVPLLLMQACEDKLVDKTRVRTWFDNVKISDKAFKEWPNCYHELLN
EYERDEILNYIQSFTEIRINNIIETNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagcagaggaagcgaaagctgtagtcgttatcgtgcacggcgcaatg
gaatatcacggacgttacgaagctatagcagaaatgtggaatcatatcggctaccacgtt
gtgatgggagaccttccatcacatggaacgacttcgagaaatagaggacatattgattca
tttgatgaatacatagaggaagttaaattatgggtgaaagaggcaaggaagtatcgatta
cctatttttatatttggtcatagtatgggtggtcttattgtcattcgtatgatgcaagaa
acgaagagagaagatgtagatggtattattttaagttcaccatgtttaggtgtattaact
ggaccttctgctccgcttcgagctgcctcaaaaatattaaatgttgttgctccaaaattg
caatttgcaacgaatcttacagtggaaatgtcaactcgtaatcatgaagtgagagatgcg
atggagaatgattcattgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctatcgaaattgcgcataaaaaaataggcgattttccagacgttccactcttgcta
atgcaggcttgtgaggataaacttgtagataaaacacgtgtccgtacttggtttgataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttatcatgagttattaaat
gagtatgagcgtgatgaaattttgaattatattcagtcatttactgaaatacgcatcaat
aacataatagaaacaaataagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system