KEGG   Bacillus weihenstephanensis KBAB4: BcerKBAB4_4710Help
Entry
BcerKBAB4_4710    CDS       T00642                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bwe  Bacillus weihenstephanensis KBAB4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BcerKBAB4_4710
Enzymes [BR:bwe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BcerKBAB4_4710
Exosome [BR:bwe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BcerKBAB4_4710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4686486..4688423)
Genome map
AA seq 645 aa AA seqDB search
MDVINCEEVKRDEFHTEKYYDSYNIFGAHIVTEDGMRGVRCTVWAPHAKAMSVVGDFNEW
DYEQHKMLQVTEEGIWSLFVPHIEENEIYKYAIETMDGDVILKADPYAVYAEVRPNTASV
VFDIEGYEWNDKNWIRKRKKKSIYKEAMTVYELHFGSWKKKEDGALYSYREMAEELIPYV
VEHQFTHIEIMPLVEHPYDRSWGYQGTGYYAATSRFGTPHDLMYFVDECHKYGIGVILDW
VPGHFCKDAHGLYLFDGTPTYEYKDRDVQENLVWGTVNFDLGKREVRNFLISNALFWMKY
FHIDGFRVDAVANMLYWNKEGKEQSNEHAVSFLRELNEAVFAEDEEFLMTAEDSTAWPLV
TAPTYEGGLGFNYKWNMGWMNDVLKYMECAPEYRKYIHEKMTFSLIYAHSENFILPLSHD
EVVHGKKSLLNKMPGDYWDKFAQLRLLYGYFFTHPGKKLLFMGGEFGQFDEWKDLEDLDW
NLHDFEMHRNMHDYFKELIALYKRSKPLWQLDHSPEGFQWIDANNNEQSIFSFIRQGDKQ
EDALVVVCNFTKATYENYKVGVPDFEYYNEILNSDSAQYGGSGQVNKKRLKTILEPYHNQ
AAHVEITIPPFGVSILRPVKTRKGSKKQDGSKTKVRSNVTSRGKR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
ttggatgtaataaattgtgaagaagtgaaacgagatgagtttcatacagaaaagtactat
gacagttataacatctttggggcacatattgtgacggaagatgggatgcgaggtgtacga
tgcacagtatgggctcctcatgcgaaagcaatgagtgttgttggagattttaatgaatgg
gattatgagcaacataagatgctccaagtgacagaagaggggatttggtccttgtttgta
ccgcatattgaagagaatgagatatataagtatgcgattgaaacgatggatggtgacgtt
attttaaaagcagatccttacgcagtatatgcagaagtaagaccaaatacggcatctgta
gtttttgatatagagggatatgaatggaatgataaaaactggattcgtaagagaaagaaa
aaatcgatttataaagaagcgatgacagtttatgaattacatttcggttcttggaaaaag
aaagaagatggcgctctgtattcttacagagaaatggccgaggagctcattccgtatgtg
gtggaacatcaatttacacatattgaaattatgccgcttgttgagcatccctatgaccgt
tcttggggatatcaaggaacaggatattatgcagcgacaagtagattcggcacgccacat
gatttgatgtattttgtcgatgaatgtcataaatatggaatcggtgtcattttagattgg
gtaccggggcatttttgtaaagatgctcacggtttatatttgtttgatgggacaccgact
tatgaatataaagatagagatgtacaagaaaaccttgtatggggaactgttaattttgat
ttagggaagagagaagtacgtaatttcttaatttcaaatgcgttattttggatgaagtat
ttccatattgatggtttcagggtagatgcagttgcgaatatgctgtactggaataaagaa
ggaaaagagcaaagcaatgaacatgctgtttctttcttacgagagttaaatgaagccgtg
tttgcagaagatgaagagtttcttatgacagcggaagattcaacagcttggccacttgta
acagctccaacatacgagggtggacttggattcaattataaatggaatatgggttggatg
aatgatgtgctgaaatatatggaatgtgcgccagagtaccggaaatacattcatgagaaa
atgacattctctttaatatatgctcactctgaaaacttcatattgccgctttctcatgat
gaagtcgttcatgggaaaaagtcgttattaaataaaatgccgggagattactgggataag
tttgctcagcttcgtttattatatggatatttctttactcatccaggtaagaaattactc
tttatgggtggagaattcgggcaatttgatgagtggaaagaccttgaagatttagattgg
aatttacatgattttgaaatgcatcgtaatatgcatgattactttaaagagctcatagca
ttgtataagcgctcaaaaccactttggcagttagatcactcgcctgaaggatttcagtgg
attgatgctaataataatgagcaaagtattttctcgtttatccgccaaggggataagcag
gaagatgcgttagttgtcgtatgtaattttacgaaagctacatatgaaaactataaagta
ggtgtaccagatttcgagtactataacgaaattttaaacagtgactcggcgcaatatggc
ggatcggggcaagttaataagaaacgtctcaagacgattctagagccatatcataatcaa
gcggcacatgtagaaattacaattccaccatttggcgtatccatattacgaccagtgaag
acgagaaaggggagcaaaaaacaagatggctcaaaaacaaaagtgcgtagcaatgttact
agcagggggaaaaggtag

DBGET integrated database retrieval system