KEGG   Bacillus mycoides KBAB4: BcerKBAB4_4922Help
Entry
BcerKBAB4_4922    CDS       T00642                                 

Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
bwe  Bacillus mycoides KBAB4
Brite
Enzymes [BR:bwe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BcerKBAB4_4922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 DLH Abhydrolase_6 Peptidase_S9 DUF676 BAAT_C UPF0227 Esterase
Motif
Other DBs
NCBI-ProteinID: ABY46070
JGI: BcerKBAB44922
UniProt: A9VQ43
Position
complement(4886909..4887652)
Genome map
AA seq 247 aa AA seqDB search
MMKLASPKPFTFEGGDRAVLLLHGFTGNSADVRMLGRFLEKKGYTCHAPIYKGHGVPPEE
LVHTGPEDWWKDVMNAYQHLKDQGYEKIAAVGLSLGGVFSLKLAYTLPILGVVPMCAPMY
IKSEEIMYQGILAYAREYKKREQKSPERIEQEMFEFKQTPMNTLKALQELIRDVRNNVDM
IYAPTFVVQARHDEMINTDSANIIYNGVESTLKDIKWYEDSTHVITLDKERDVLHEDVYN
FLEQLDW
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattagcatctccaaaaccatttacatttgaaggtggagaccgcgctgtttta
ttattacatggattcacagggaactcagctgacgtacgcatgctagggcgtttcttagag
aagaaaggctatacttgtcatgcgccaatttataaaggacacggtgtaccaccagaagag
cttgttcatacaggtcctgaagactggtggaaagatgtaatgaatgcctaccagcattta
aaagatcaaggttacgagaaaatagctgcggttggattatcattaggcggagtattctca
ttaaaacttgcttatacattaccgattttaggtgttgtaccaatgtgtgcaccgatgtac
attaaaagtgaagaaattatgtaccaaggtatattggcatatgcccgcgaatataaaaag
cgtgagcaaaaatcaccagaacgaattgagcaggaaatgtttgaatttaaacagacacca
atgaatacattaaaagcattacaggagttgattcgtgacgtacgcaataatgttgatatg
atttatgctccaacattcgttgtacaagcacgtcatgatgagatgattaatacagatagt
gctaacattatttataacggtgtagaatctacgttaaaagacattaaatggtatgaagac
tctacgcatgtcattacacttgataaagaacgtgatgtgctacatgaggatgtatataac
ttcttggagcaactagattggtaa

DBGET integrated database retrieval system