KEGG   Bacillus weihenstephanensis KBAB4: BcerKBAB4_5071Help
Entry
BcerKBAB4_5071    CDS       T00642                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bwe  Bacillus weihenstephanensis KBAB4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BcerKBAB4_5071
   00052 Galactose metabolism
    BcerKBAB4_5071
   00500 Starch and sucrose metabolism
    BcerKBAB4_5071
   00520 Amino sugar and nucleotide sugar metabolism
    BcerKBAB4_5071
Enzymes [BR:bwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BcerKBAB4_5071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5039277..5040158)
Genome map
AA seq 293 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKG
KRAIEDHFDHSFELEQNLLEKGKHEMLKKVQASSRINIHYIRQKEPKGLGHAVWCARKFI
GNEPFAVLLGDDIVQAETPCLRQLMDQYEGTQLSVIGVQTVPENETHRYGIIDPVEQNDR
RYQVRQFVEKPAEGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEIQ
RVFAYDFEGTRYDVGEKFGFIKTTIEMALQHKELREELIRYMSELLEEEILHA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtaagaaaagcgattatacccgctgctggtcttgggacaagatttctacca
gcgacgaaagcgatgccgaaagaaatgttaccgatagtcgacaaaccgacaattcaatac
atagtagaagaagcgatagaatcaggaattgaagatattattattgtaactggaaaagga
aaacgtgcaattgaagatcattttgatcattcttttgagttagaacaaaaccttttagaa
aaaggtaagcacgaaatgcttaagaaagtacaagcttcttcaagaattaatattcattac
ataagacaaaaagagccaaaaggacttggtcacgcagtatggtgtgcgcgcaagtttatt
ggaaatgagccatttgcggtattacttggtgatgatattgtacaagcagaaacaccatgt
ttacgtcaattaatggatcaatatgaaggaacgcaattatctgttattggtgtgcaaacc
gtaccagaaaatgagactcatcgttacggtattattgatcctgttgaacaaaatgaccgt
cgctatcaagtgcgtcaatttgttgaaaaaccagcagaaggtacagcaccatctaattta
gcgattatggggcgttatgtattaacgccagaaatttttatgttccttgaaaatcaacaa
acaggtgctggtggggaaattcaattaactgatgcaattcaacgattaaatgagattcaa
cgtgtgtttgcttatgattttgaaggtacacgttatgacgttggtgagaagtttggattt
attaagactacaattgagatggcgcttcagcataaagaattaagggaagaattgataaga
tatatgagtgagctattggaagaagaaatacttcatgcgtag

DBGET integrated database retrieval system