KEGG   Bacillus mycoides KBAB4: BcerKBAB4_5132Help
Entry
BcerKBAB4_5132    CDS       T00642                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00520  Amino sugar and nucleotide sugar metabolism
bwe00550  Peptidoglycan biosynthesis
bwe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BcerKBAB4_5132
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BcerKBAB4_5132
Enzymes [BR:bwe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BcerKBAB4_5132
Peptidoglycan biosynthesis and degradation proteins [BR:bwe01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   BcerKBAB4_5132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ABY46278
JGI: BcerKBAB45132
UniProt: A9VSD2
Position
complement(5096348..5097637)
Genome map
AA seq 429 aa AA seqDB search
MEKLLIEGGRALNGTIRVSGAKNSAVALIPATILADTPVTIGGVPNISDVKMLGDLLEEI
GGKVTYGQEEEMVVDPSNMVAMPLPNGKVKKLRASYYLMGAMLGRFKKAVIGLPGGCHLG
PRPIDQHIKGFEALGAYVTNEQGAIYLRADELRGARIYLDVVSVGATINIMLVAVRAKGR
TVIENAAKEPEIIDVATLLTSMGARIKGAGTDVIRIDGVDSLHGCHHTIIPDRIEAGTYM
ILGAASGGEVTVDNVIPQHLESVTAKLREAGVQIETNDDQITVNGNRRLKVVDVKTLVYP
GFPTDLQQPFTTLLTKAHGTGVVTDTIYSARFKHIDELRRMNAQIKVEGRSAIVTGPVLL
QGAKVKASDLRAGASLVIAGLMADGITEVTGLDHIDRGYENIVDKLKGLGANIWREQMTK
QEIEEMKNA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttgctaattgaaggcggaagagctttaaatggaacgattcgtgtgagtggt
gcaaagaacagtgctgttgcactaattccagcgacaattttagcagatactccagtaact
attggcggtgttcctaatatttcggacgtgaaaatgttaggagacttactagaggaaatt
ggagggaaagtaacttatgggcaggaagaagagatggtagtcgatccttctaacatggtt
gcgatgcctttaccaaatggaaaagtgaaaaaattgcgcgcctcttattatttaatgggt
gcaatgcttggccgttttaaaaaagctgttattgggcttccaggtggatgtcatttaggg
ccacgaccgattgatcagcatattaaagggtttgaagcgttaggggcatatgttacaaat
gaacaaggtgccatttatttaagagcagacgaactacgtggggcacgtatttatttagat
gttgttagtgtaggagctacgattaatattatgctagtggctgtacgagcgaaaggtaga
actgttattgaaaatgcagcgaaagaaccagagattattgatgtagctacattgttaacg
agtatgggagcacgtattaaaggtgctggtacagacgtaatccgaattgatggtgtggat
tcactgcacggttgtcaccacactattattccagaccgtattgaagctggtacgtatatg
attttaggagcagcatcaggaggagaagtaacagttgataatgttattcctcagcattta
gaatccgttactgcgaagctaagagaagctggtgttcaaattgaaacgaacgatgaccaa
attacagtgaacggcaatagaaggttaaaagtagttgatgtaaaaacgcttgtatatcca
gggtttccaacggatttacaacagccgtttacaacgcttttaacaaaagcgcatggaaca
ggagttgtaactgatacaatttacagcgcacgtttcaagcatattgatgaattgcgccgt
atgaacgcgcaaattaaagtagaaggccgttcagcaattgtgactggaccagttttattg
caaggtgcgaaggtgaaagcgagtgacctacgagctggtgcatcccttgttattgcgggt
ttaatggcagatggcattacagaagtaacgggacttgatcatattgatcgaggttacgaa
aatatagtagacaagcttaaagggcttggtgcaaacatttggcgagaacaaatgacaaag
caagaaattgaagaaatgaagaatgcataa

DBGET integrated database retrieval system