KEGG   Bacillus mycoides KBAB4: BcerKBAB4_5423Help
Entry
BcerKBAB4_5423    CDS       T00642                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00040  Pentose and glucuronate interconversions
bwe00052  Galactose metabolism
bwe00500  Starch and sucrose metabolism
bwe00520  Amino sugar and nucleotide sugar metabolism
bwe01100  Metabolic pathways
bwe01130  Biosynthesis of antibiotics
Module
bwe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BcerKBAB4_5423
   00052 Galactose metabolism
    BcerKBAB4_5423
   00500 Starch and sucrose metabolism
    BcerKBAB4_5423
   00520 Amino sugar and nucleotide sugar metabolism
    BcerKBAB4_5423
Enzymes [BR:bwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BcerKBAB4_5423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABY46768
JGI: BcerKBAB45423
UniProt: A9VVF3
Position
pBWB402:complement(63997..64818)
Genome map
AA seq 273 aa AA seqDB search
MIKKAIIPAAGYGTRSLPITKVIPKEMFPIGNKPAIHYIVEEAVKSGIEQILIVLSSRKD
LIVDYFDYSLELEAFLEKEKKAHLLKGLAIPNVQIHYIRQPYARGLGEAIKLGETFIGNE
PFAVLLPDDIVVSDKETALNQLISIYKETKNSVIGIHTVPDECIEKYGIIEGNIVKGNYM
NITNIIEKPKVNPPSNLAVIGRYVFTPDIFPLLKNIQPGVGGEYQLTDAIHSLIMTKKVY
GKMIDGKRFDIGQEDEYMQLLNLIYGQNKTGKN
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaaaaagcaatcattccagccgctggttacggcacaaggagccttccaattaca
aaggtaattccaaaagaaatgtttccaataggtaataaacctgcgattcattatattgtg
gaagaggctgtaaagtcaggtattgagcaaatattaattgtactttctagcagaaaggat
ttaatagttgattactttgattattcattagaattggaggcttttttagaaaaagaaaaa
aaagcccatctgttaaaagggcttgctattcctaatgttcaaatccattatataaggcag
ccatatgcgagaggacttggtgaggcgataaaattaggtgaaacatttattggtaatgaa
ccttttgctgtactcttgccagatgatattgtagtctcggataaagaaactgctttaaat
cagttaattagtatttataaagagacgaaaaatagtgtaataggcattcatacggtacca
gatgagtgcatagaaaagtatggtattattgaagggaatattgtaaagggtaattacatg
aatattacaaatattatagaaaagccaaaagtaaatcctccatctaatcttgcagttatt
ggtagatatgttttcacacctgatatctttcctttattaaaaaatattcaacctggtgtt
gggggggaataccaattaacagatgcgattcattctttaattatgactaaaaaagtatat
ggaaaaatgattgatgggaaacgatttgatattgggcaagaagatgaatatatgcagctt
cttaatctcatatatggacaaaacaaaacaggtaagaattaa

DBGET integrated database retrieval system