KEGG   Bacillus weihenstephanensis: BcerKBAB4_5571Help
Entry
BcerKBAB4_5571    CDS       T00642                                 

Definition
L-serine dehydratase, iron-sulfur-dependent subunit beta
Orthology
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
bwe  Bacillus weihenstephanensis
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:bwe01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bwe01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bwe00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bwe00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBWB401:complement(173293..173991)
Genome map
AA seq 232 aa AA seqDB search
MNMNVASIKEKKVVKYKSCFDVIGPVMIGPSSSHTAGALAIGTVANKLFQGLPKKVVVRY
YESFAETHKGHGTDFAIIAGILGFAADDSKVPDAIKIAESKGIDITFIEKAGDSPAGHPN
TADVYLEDESRSIRTMGISVGGGLIEVKHVEIDGFSLDLQGPLPVIIAISERADFEFVLR
RVFKQYDVEINNFHSLEENRKYLYAFALDSLLPGYVQKELGNLSNIANVIIL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgaatgtagcatctattaaagaaaaaaaggttgttaaatacaaaagttgtttt
gatgtgattgggccggtaatgataggtccttcaagttcacatactgcaggtgctttggct
attgggacagttgccaataaattatttcaaggtcttccaaaaaaagtcgtggtaaggtat
tatgaatcatttgctgaaacccataaaggacacggaactgattttgcaattattgctggg
atattaggatttgctgccgatgacagcaaagtgccagatgctattaaaatagcagaatct
aaaggaattgacattacctttattgaaaaagcgggtgatagtcctgctggtcatcccaat
acggcagatgtatatttagaggatgaaagccgaagtattagaacgatgggtatttcggtc
ggcggtggattaattgaagtcaaacatgttgaaattgacggatttagcttagatctgcag
gggccattgccagttattattgcgatttctgaaagagctgactttgaatttgtcttacgc
agggtctttaaacaatatgatgtggaaattaacaactttcatagtttagaagaaaacaga
aaatatttatatgcattcgctttggattcgctattgcctggttatgttcagaaggaattg
ggaaatttaagcaatatagctaatgtcattattctttag

DBGET integrated database retrieval system