KEGG   Burkholderia xenovorans LB400: Bxe_A0054Help
Entry
Bxe_A0054         CDS       T00340                                 

Definition
glycine dehydrogenase (EC:1.4.4.2)
Orthology
K00281  
glycine dehydrogenase [EC:1.4.4.2]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bxe_A0054
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bxe_A0054
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     Bxe_A0054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4781846..4784782
Genome map
AA seq 978 aa AA seqDB search
MKLEHPDRLMNRTPLSLAALEVHDAFAERHIGPDSADQQAMLEALGFASRAALIDAVIPK
TIRRTEPLPLGPFAQPKSEAEALATLRELADRNQVFRSYIGQGYYNAHTPTVILRNVLEN
PAWYTAYTPYQPEISQGRLEALLNFQQMIVDLTGLAISNASLLDEATAAAEAMTLLQRIG
KPKSNVFYVADDVLPQTIEVVKTRATPVGIEVKVGPAADAANANAFGVLLQYPGVNGDVR
DYRALAEAIHAAGGHVVVAADLLALTVLTPPGEWGADVAVGNTQRFGVPVGFGGPHAAYL
AVRDEFKRQMPGRLVGVTVDAQGNPALRLALQTREQHIRREKATSNVCTAQALLAIMASM
YAVYHGPHGLKTIALRVNRIAALLAEGAKQLGYTLVNETFFDTLTFETGARTQALHDAAL
AKRINLRRVSDTQVGLSVDETTTRRDLADLLEVFAQAAGAKIVPQVDALDSTIAASDTAS
VPPALERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEM
LPVTWPEFGQIHPFAPAEQTVGYREMIDQLEAMLVAATGYAAVSLQPNAGSQGEYAGLLI
IHAYHASRGEAHRNVCLIPASAHGTNPASAHMAGMQVIVVACDAQGNVDIEDLKKKAEQH
ADKLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTAPGQFGGDVS
HLNLHKTFCIPHGGGGPGVGPVAVGAHLAQFLPNQISSGYERAPNGIGAVSGAPYGSASI
LPISWMYIAMMGAKNLTAATETAILNANYVAKKLAPHYPVLYSGPGGLVAHECILDLRPI
KETSGITVDDVAKRLADYGFHAPTMSFPVPGTLMVEPTESESKEELDRFIEAMIAIREEI
RAVEEGRSDREDNPLKHAPHTAAVVIANDWKHAYARETAAYPLPTLIAKKYWPPVGRADN
VYGDRNLFCSCVPIADYE
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgaacacccggatcgtctgatgaaccgcactcctctctcgctcgccgcgctc
gaagtgcatgacgccttcgccgaacggcacatcggcccggattcggccgaccagcaagcg
atgctcgaagccctcggcttcgcgtcgcgcgccgcgctgatcgacgccgtcattccgaag
acgatccgccgcaccgaaccgctgccgctcggccccttcgcgcaaccgaaaagcgaagcc
gaagcgctcgccacgctgcgcgagctcgcggacaggaaccaggtgttccgctcgtacatc
ggccagggctattacaacgcgcacacgccgacggtgatcctgcgtaacgtgctggaaaat
ccggcgtggtacaccgcgtacacgccgtaccagccagaaatttcgcaaggccgtctggaa
gcgctactgaacttccagcagatgatcgtcgacctgacgggtctggcgatctcgaatgcg
tcgctgctcgacgaagccacggccgcggccgaggcgatgacgctgctgcaacgcatcggc
aagccgaagtcgaacgtgttctatgtggccgacgacgtgctgccgcaaaccatcgaagtg
gtgaagacgcgcgccacgccggtgggcattgaagtgaaagtgggcccggctgcggacgcg
gcgaacgcgaacgcgttcggcgtactgctgcaatacccgggcgtgaacggcgacgtgcgc
gactaccgcgccctggccgaagcgatccacgccgcgggcggccacgtggtggtcgccgcc
gacctgctcgcgctgaccgtcctcacgccgccgggcgaatggggcgcggacgtggccgtc
ggcaacacgcagcgcttcggcgtgccggtcggcttcggcggcccgcatgcggcttacctc
gccgtgcgcgacgaattcaagcgccagatgccgggccgcctcgtcggcgtgaccgtcgac
gcgcaaggcaaccccgcgctgcgtctcgcgctgcaaacgcgcgaacagcatatccgccgc
gagaaggccacctcgaacgtatgtaccgcgcaagcattgctcgcgatcatggccagcatg
tacgccgtgtatcacggcccgcacggcctgaaaacgatcgcgctgcgcgtgaaccggatc
gccgcgctgctggcagaaggtgcgaagcaactcggctacacgctcgtcaacgaaacgttc
ttcgacacgctcacattcgaaaccggcgcgcgcacgcaagcgctgcatgacgccgcgctt
gcgaagcgcatcaacctgcgccgcgtgagcgacacgcaagtgggcctgtcggtcgacgaa
accaccacgcgccgcgatctggccgatctgctcgaagtgttcgcacaagccgcgggcgcc
aaaatcgtgccgcaagtggacgcgctcgactcgaccatcgccgcatcggatacggcatcg
gtgccgcccgcgctcgagcgcaccagcgcgtatctcacgcaccacgtattcaaccgccat
cattcggaaacggaaatgctgcgctatctgcgcagcctgtcggacaaagacctcgcgctc
gaccgctcgatgatcccgctcggctcgtgcacgatgaagctgaacgcgacctcggaaatg
ctgccggtcacgtggcctgaattcggccagatccatccgttcgcgccggccgagcaaacc
gtcggctatcgcgaaatgatcgatcagctcgaagcgatgctggtcgcggccaccggctac
gctgccgtgtcgctgcaaccgaatgccggctcgcaaggcgagtacgcgggcctgttgatc
attcacgcgtatcacgcgtcgcgtggcgaagcgcatcgcaatgtctgcctgattcccgct
tcggcgcacggcacgaacccggcctcggcacacatggccggcatgcaggtgatcgtggtg
gcgtgcgacgcgcaaggcaacgtcgatatcgaagacctgaagaaaaaggccgaacagcac
gccgacaaactcgcggcgatcatgatcacgtatccttccacgcacggcgtgttcgagcag
aacgtgcgcgaaatctgcgagatcgtgcatgcgcacggcggtcaggtctacgtggacggc
gcgaacatgaacgcgatggtcggcctcactgcgccgggccagttcggcggcgacgtgtcg
cacctgaatctgcacaagacgttctgcattccgcacggcggcggcggaccgggcgtcggt
ccggtcgcggtcggcgcgcatctcgcgcagttcctgccgaatcagatctcgtcgggctac
gaacgcgcgccgaacggtatcggcgccgtgtcgggcgcaccgtacggctcggcgtctatc
ctgccgatctcgtggatgtatatcgcgatgatgggcgcgaagaacctcaccgccgcgacc
gaaaccgcgatcctcaacgcgaactacgtcgcgaagaaactcgcgccgcactatccggtg
ctgtattcgggcccgggcggactggtcgcgcacgagtgcattctcgacctgcgcccgatc
aaggaaaccagcggcattaccgtcgacgacgtcgccaagcgtctcgccgactacggcttc
catgcgccgaccatgagcttcccggtgccgggcacgctgatggtcgagccgaccgaatcg
gaatcgaaggaagaactcgaccgtttcatcgaagcgatgatcgcgatccgcgaggaaatc
cgcgcagtcgaagaaggccgctcggaccgcgaggacaatccgctgaagcatgcaccgcat
acggcggcggtggtcatcgcgaatgactggaagcatgcgtatgcgcgcgaaaccgcggcg
tatccgctgcccacgctgatcgcgaaaaaatactggccgccggtcggccgcgcggacaac
gtgtacggcgaccgcaatctgttctgctcctgcgtgccgatcgccgattacgagtaa

DBGET integrated database retrieval system