KEGG   Burkholderia xenovorans: Bxe_A0054Help
Entry
Bxe_A0054         CDS       T00340                                 

Definition
glycine dehydrogenase (EC:1.4.4.2)
Orthology
K00281  
glycine dehydrogenase [EC:1.4.4.2]
Organism
bxe  Burkholderia xenovorans
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bxe01200]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bxe00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4781846..4784782
Genome map
AA seq 978 aa AA seqDB search
MKLEHPDRLMNRTPLSLAALEVHDAFAERHIGPDSADQQAMLEALGFASRAALIDAVIPK
TIRRTEPLPLGPFAQPKSEAEALATLRELADRNQVFRSYIGQGYYNAHTPTVILRNVLEN
PAWYTAYTPYQPEISQGRLEALLNFQQMIVDLTGLAISNASLLDEATAAAEAMTLLQRIG
KPKSNVFYVADDVLPQTIEVVKTRATPVGIEVKVGPAADAANANAFGVLLQYPGVNGDVR
DYRALAEAIHAAGGHVVVAADLLALTVLTPPGEWGADVAVGNTQRFGVPVGFGGPHAAYL
AVRDEFKRQMPGRLVGVTVDAQGNPALRLALQTREQHIRREKATSNVCTAQALLAIMASM
YAVYHGPHGLKTIALRVNRIAALLAEGAKQLGYTLVNETFFDTLTFETGARTQALHDAAL
AKRINLRRVSDTQVGLSVDETTTRRDLADLLEVFAQAAGAKIVPQVDALDSTIAASDTAS
VPPALERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEM
LPVTWPEFGQIHPFAPAEQTVGYREMIDQLEAMLVAATGYAAVSLQPNAGSQGEYAGLLI
IHAYHASRGEAHRNVCLIPASAHGTNPASAHMAGMQVIVVACDAQGNVDIEDLKKKAEQH
ADKLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTAPGQFGGDVS
HLNLHKTFCIPHGGGGPGVGPVAVGAHLAQFLPNQISSGYERAPNGIGAVSGAPYGSASI
LPISWMYIAMMGAKNLTAATETAILNANYVAKKLAPHYPVLYSGPGGLVAHECILDLRPI
KETSGITVDDVAKRLADYGFHAPTMSFPVPGTLMVEPTESESKEELDRFIEAMIAIREEI
RAVEEGRSDREDNPLKHAPHTAAVVIANDWKHAYARETAAYPLPTLIAKKYWPPVGRADN
VYGDRNLFCSCVPIADYE
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgaacacccggatcgtctgatgaaccgcactcctctctcgctcgccgcgctc
gaagtgcatgacgccttcgccgaacggcacatcggcccggattcggccgaccagcaagcg
atgctcgaagccctcggcttcgcgtcgcgcgccgcgctgatcgacgccgtcattccgaag
acgatccgccgcaccgaaccgctgccgctcggccccttcgcgcaaccgaaaagcgaagcc
gaagcgctcgccacgctgcgcgagctcgcggacaggaaccaggtgttccgctcgtacatc
ggccagggctattacaacgcgcacacgccgacggtgatcctgcgtaacgtgctggaaaat
ccggcgtggtacaccgcgtacacgccgtaccagccagaaatttcgcaaggccgtctggaa
gcgctactgaacttccagcagatgatcgtcgacctgacgggtctggcgatctcgaatgcg
tcgctgctcgacgaagccacggccgcggccgaggcgatgacgctgctgcaacgcatcggc
aagccgaagtcgaacgtgttctatgtggccgacgacgtgctgccgcaaaccatcgaagtg
gtgaagacgcgcgccacgccggtgggcattgaagtgaaagtgggcccggctgcggacgcg
gcgaacgcgaacgcgttcggcgtactgctgcaatacccgggcgtgaacggcgacgtgcgc
gactaccgcgccctggccgaagcgatccacgccgcgggcggccacgtggtggtcgccgcc
gacctgctcgcgctgaccgtcctcacgccgccgggcgaatggggcgcggacgtggccgtc
ggcaacacgcagcgcttcggcgtgccggtcggcttcggcggcccgcatgcggcttacctc
gccgtgcgcgacgaattcaagcgccagatgccgggccgcctcgtcggcgtgaccgtcgac
gcgcaaggcaaccccgcgctgcgtctcgcgctgcaaacgcgcgaacagcatatccgccgc
gagaaggccacctcgaacgtatgtaccgcgcaagcattgctcgcgatcatggccagcatg
tacgccgtgtatcacggcccgcacggcctgaaaacgatcgcgctgcgcgtgaaccggatc
gccgcgctgctggcagaaggtgcgaagcaactcggctacacgctcgtcaacgaaacgttc
ttcgacacgctcacattcgaaaccggcgcgcgcacgcaagcgctgcatgacgccgcgctt
gcgaagcgcatcaacctgcgccgcgtgagcgacacgcaagtgggcctgtcggtcgacgaa
accaccacgcgccgcgatctggccgatctgctcgaagtgttcgcacaagccgcgggcgcc
aaaatcgtgccgcaagtggacgcgctcgactcgaccatcgccgcatcggatacggcatcg
gtgccgcccgcgctcgagcgcaccagcgcgtatctcacgcaccacgtattcaaccgccat
cattcggaaacggaaatgctgcgctatctgcgcagcctgtcggacaaagacctcgcgctc
gaccgctcgatgatcccgctcggctcgtgcacgatgaagctgaacgcgacctcggaaatg
ctgccggtcacgtggcctgaattcggccagatccatccgttcgcgccggccgagcaaacc
gtcggctatcgcgaaatgatcgatcagctcgaagcgatgctggtcgcggccaccggctac
gctgccgtgtcgctgcaaccgaatgccggctcgcaaggcgagtacgcgggcctgttgatc
attcacgcgtatcacgcgtcgcgtggcgaagcgcatcgcaatgtctgcctgattcccgct
tcggcgcacggcacgaacccggcctcggcacacatggccggcatgcaggtgatcgtggtg
gcgtgcgacgcgcaaggcaacgtcgatatcgaagacctgaagaaaaaggccgaacagcac
gccgacaaactcgcggcgatcatgatcacgtatccttccacgcacggcgtgttcgagcag
aacgtgcgcgaaatctgcgagatcgtgcatgcgcacggcggtcaggtctacgtggacggc
gcgaacatgaacgcgatggtcggcctcactgcgccgggccagttcggcggcgacgtgtcg
cacctgaatctgcacaagacgttctgcattccgcacggcggcggcggaccgggcgtcggt
ccggtcgcggtcggcgcgcatctcgcgcagttcctgccgaatcagatctcgtcgggctac
gaacgcgcgccgaacggtatcggcgccgtgtcgggcgcaccgtacggctcggcgtctatc
ctgccgatctcgtggatgtatatcgcgatgatgggcgcgaagaacctcaccgccgcgacc
gaaaccgcgatcctcaacgcgaactacgtcgcgaagaaactcgcgccgcactatccggtg
ctgtattcgggcccgggcggactggtcgcgcacgagtgcattctcgacctgcgcccgatc
aaggaaaccagcggcattaccgtcgacgacgtcgccaagcgtctcgccgactacggcttc
catgcgccgaccatgagcttcccggtgccgggcacgctgatggtcgagccgaccgaatcg
gaatcgaaggaagaactcgaccgtttcatcgaagcgatgatcgcgatccgcgaggaaatc
cgcgcagtcgaagaaggccgctcggaccgcgaggacaatccgctgaagcatgcaccgcat
acggcggcggtggtcatcgcgaatgactggaagcatgcgtatgcgcgcgaaaccgcggcg
tatccgctgcccacgctgatcgcgaaaaaatactggccgccggtcggccgcgcggacaac
gtgtacggcgaccgcaatctgttctgctcctgcgtgccgatcgccgattacgagtaa

DBGET integrated database retrieval system