KEGG   Burkholderia xenovorans: Bxe_A0162Help
Entry
Bxe_A0162         CDS       T00340                                 

Definition
flagellar FliJ protein
Orthology
K02413  
flagellar FliJ protein
Organism
bxe  Burkholderia xenovorans
Pathway
Flagellar assembly
Class
Cellular Processes; Cell motility; Flagellar assembly [PATH:bxe02040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4675404..4675853
Genome map
AA seq 149 aa AA seqDB search
MAKHFPIKTLIGLAQDDVDAAAQRLGRAQRERNDVQSQLDALVQYRDEYHARFTASAQTG
MPAGNMRNFQAFIDTLDAAIEQQRNLLATATARVEAAKPDWQRQKQKLGSYEVLQARGEA
AEARTTARRDQRDADEHAARILRTRTEGA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacacttcccgatcaagacactcatcggcctggctcaggacgatgtggacgcc
gcggcgcaacgtctgggccgcgcgcagcgcgagcgcaacgacgtgcaatcgcaactcgat
gctctcgtgcagtatcgcgacgaatatcacgcgcgcttcacggcatccgcccagacgggc
atgcccgcgggcaacatgcgcaacttccaggcattcatcgacacgctcgacgccgccatc
gaacagcagcgcaacctgctggcgacggccaccgcgcgcgtcgaggccgcgaaaccggac
tggcagcgtcagaagcagaagctcggttcgtatgaagtgctgcaggcgcgcggcgaagcc
gccgaagccaggaccacggcgcggcgcgatcagcgcgacgccgacgaacacgcggcccgg
attctgagaacgcgcaccgaaggcgcatga

DBGET integrated database retrieval system