KEGG   Burkholderia xenovorans LB400: Bxe_A0162Help
Entry
Bxe_A0162         CDS       T00340                                 

Definition
flagellar FliJ protein
Orthology
K02413  
flagellar FliJ protein
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    Bxe_A0162
Bacterial motility proteins [BR:bxe02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    Bxe_A0162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4675404..4675853
Genome map
AA seq 149 aa AA seqDB search
MAKHFPIKTLIGLAQDDVDAAAQRLGRAQRERNDVQSQLDALVQYRDEYHARFTASAQTG
MPAGNMRNFQAFIDTLDAAIEQQRNLLATATARVEAAKPDWQRQKQKLGSYEVLQARGEA
AEARTTARRDQRDADEHAARILRTRTEGA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacacttcccgatcaagacactcatcggcctggctcaggacgatgtggacgcc
gcggcgcaacgtctgggccgcgcgcagcgcgagcgcaacgacgtgcaatcgcaactcgat
gctctcgtgcagtatcgcgacgaatatcacgcgcgcttcacggcatccgcccagacgggc
atgcccgcgggcaacatgcgcaacttccaggcattcatcgacacgctcgacgccgccatc
gaacagcagcgcaacctgctggcgacggccaccgcgcgcgtcgaggccgcgaaaccggac
tggcagcgtcagaagcagaagctcggttcgtatgaagtgctgcaggcgcgcggcgaagcc
gccgaagccaggaccacggcgcggcgcgatcagcgcgacgccgacgaacacgcggcccgg
attctgagaacgcgcaccgaaggcgcatga

DBGET integrated database retrieval system