KEGG   Burkholderia xenovorans: Bxe_A0286Help
Entry
Bxe_A0286         CDS       T00340                                 

Definition
4-hydroxyphenylpyruvate dioxygenase (EC:1.13.11.27)
Orthology
K00457  
4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
bxe  Burkholderia xenovorans
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Tyrosine metabolism
Phenylalanine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bxe00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:bxe00360]
Metabolism; Metabolism of cofactors and vitamins; Ubiquinone and other terpenoid-quinone biosynthesis [PATH:bxe00130]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4551765..4552862
Genome map
AA seq 365 aa AA seqDB search
MQVSTWENPLGTDGFEFIEYTAPDPKALGKLFEQMGFTAIARHRHKDVTLYRQGEINFIV
NAEPDSFAQRFARLHGPSICAIAFRVQDAAKAYQQALEKGAWGFDNKTGPMELNIPAIKG
IGDSLIYFVDRWRGKNGAEPNSVGNIDIYDVDFEPIPGANPNPVGHGLTYIDHLTHNVHR
GRMQEWAEFYERLFNFREVRYFDIEGKVTGVKSKAMTSPCGKIRIPINEEGSDTAGQIQE
YLDAYRGEGIQHIALGTNDIYRTVDGLRAANISLLDTIDTYYELVDRRVPNHGEPLDELR
KRKILIDGAPEDLLLQIFTENQIGPIFFEIIQRKGNQGFGEGNFKALFESIELDQIRRGV
VQDKA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtttcaacctgggaaaacccgctcggcaccgacggtttcgagttcatcgaatac
accgcaccggatccgaaggcgctcggcaagctgttcgaacagatgggcttcaccgcgatc
gcgcggcatcgtcataaggacgtgacgctgtatcgccagggggaaatcaactttatcgtc
aacgcggagccggattcgttcgcgcaacgcttcgcgcgtctgcacggcccgtcgatctgc
gcgatcgctttccgcgttcaggacgccgccaaggcgtaccagcaggcgctggaaaaaggc
gcatggggcttcgacaacaaaaccggcccgatggaattgaacattccggcgatcaaaggt
attggcgactcgctgatctatttcgtcgaccgttggcgcggcaagaacggcgccgagccg
aacagcgtcggcaacatcgacatttacgacgtcgacttcgagccgattcccggtgcgaac
ccgaatccggtgggtcatggcctgacctacatcgaccatctgacacacaacgtgcatcgc
ggccgcatgcaggagtgggcggagttctacgagcgcctgttcaatttccgcgaagtgcgc
tatttcgacattgaaggcaaagtgacgggcgtgaagtcgaaggcgatgacctcgccatgc
ggcaagatccgcattccgatcaacgaggaaggttcggacaccgctggccagattcaggaa
tatctcgacgcgtaccgcggcgaaggcattcagcacattgcgctcggcaccaacgacatc
tatcgcacggtggacggcttgcgcgcggcgaacatctcgctgctcgatacgatcgacact
tactatgaactggtcgatcgccgcgtgccgaatcacggcgagccgctggacgagctgcgc
aagcgcaagattctgatcgacggcgcgcccgaagatctgctgctgcagatcttcaccgaa
aaccagatcggcccgattttcttcgagatcattcagcgcaagggcaatcagggctttggc
gaaggcaacttcaaggcgctgttcgaatcgatcgagctggatcagattcgccgtggcgtg
gtgcaggacaaagcctga

DBGET integrated database retrieval system