KEGG   Paraburkholderia xenovorans LB400: Bxe_A0286Help
Entry
Bxe_A0286         CDS       T00340                                 

Definition
(GenBank) 4-hydroxyphenylpyruvate dioxygenase
  KO
K00457  4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00130  Ubiquinone and other terpenoid-quinone biosynthesis
bxe00350  Tyrosine metabolism
bxe00360  Phenylalanine metabolism
bxe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bxe_A0286
   00360 Phenylalanine metabolism
    Bxe_A0286
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Bxe_A0286
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.27  4-hydroxyphenylpyruvate dioxygenase
     Bxe_A0286
Exosome [BR:bxe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bxe_A0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase_5 Glyoxalase Glyoxalase_4 Glyoxalase_3
Motif
Other DBs
NCBI-ProteinID: ABE32647
JGI: BxeA0286
UniProt: Q13TE2
Position
1:4551765..4552862
Genome map
AA seq 365 aa AA seqDB search
MQVSTWENPLGTDGFEFIEYTAPDPKALGKLFEQMGFTAIARHRHKDVTLYRQGEINFIV
NAEPDSFAQRFARLHGPSICAIAFRVQDAAKAYQQALEKGAWGFDNKTGPMELNIPAIKG
IGDSLIYFVDRWRGKNGAEPNSVGNIDIYDVDFEPIPGANPNPVGHGLTYIDHLTHNVHR
GRMQEWAEFYERLFNFREVRYFDIEGKVTGVKSKAMTSPCGKIRIPINEEGSDTAGQIQE
YLDAYRGEGIQHIALGTNDIYRTVDGLRAANISLLDTIDTYYELVDRRVPNHGEPLDELR
KRKILIDGAPEDLLLQIFTENQIGPIFFEIIQRKGNQGFGEGNFKALFESIELDQIRRGV
VQDKA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtttcaacctgggaaaacccgctcggcaccgacggtttcgagttcatcgaatac
accgcaccggatccgaaggcgctcggcaagctgttcgaacagatgggcttcaccgcgatc
gcgcggcatcgtcataaggacgtgacgctgtatcgccagggggaaatcaactttatcgtc
aacgcggagccggattcgttcgcgcaacgcttcgcgcgtctgcacggcccgtcgatctgc
gcgatcgctttccgcgttcaggacgccgccaaggcgtaccagcaggcgctggaaaaaggc
gcatggggcttcgacaacaaaaccggcccgatggaattgaacattccggcgatcaaaggt
attggcgactcgctgatctatttcgtcgaccgttggcgcggcaagaacggcgccgagccg
aacagcgtcggcaacatcgacatttacgacgtcgacttcgagccgattcccggtgcgaac
ccgaatccggtgggtcatggcctgacctacatcgaccatctgacacacaacgtgcatcgc
ggccgcatgcaggagtgggcggagttctacgagcgcctgttcaatttccgcgaagtgcgc
tatttcgacattgaaggcaaagtgacgggcgtgaagtcgaaggcgatgacctcgccatgc
ggcaagatccgcattccgatcaacgaggaaggttcggacaccgctggccagattcaggaa
tatctcgacgcgtaccgcggcgaaggcattcagcacattgcgctcggcaccaacgacatc
tatcgcacggtggacggcttgcgcgcggcgaacatctcgctgctcgatacgatcgacact
tactatgaactggtcgatcgccgcgtgccgaatcacggcgagccgctggacgagctgcgc
aagcgcaagattctgatcgacggcgcgcccgaagatctgctgctgcagatcttcaccgaa
aaccagatcggcccgattttcttcgagatcattcagcgcaagggcaatcagggctttggc
gaaggcaacttcaaggcgctgttcgaatcgatcgagctggatcagattcgccgtggcgtg
gtgcaggacaaagcctga

DBGET integrated database retrieval system