KEGG   Burkholderia xenovorans: Bxe_A0286Help
Entry
Bxe_A0286         CDS       T00340                                 

Definition
4-hydroxyphenylpyruvate dioxygenase (EC:1.13.11.27)
Orthology
K00457  
4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
bxe  Burkholderia xenovorans
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Tyrosine metabolism
Phenylalanine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bxe_A0286
   00360 Phenylalanine metabolism
    Bxe_A0286
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Bxe_A0286
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.27  4-hydroxyphenylpyruvate dioxygenase
     Bxe_A0286
Exosome [BR:bxe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bxe_A0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4551765..4552862
Genome map
AA seq 365 aa AA seqDB search
MQVSTWENPLGTDGFEFIEYTAPDPKALGKLFEQMGFTAIARHRHKDVTLYRQGEINFIV
NAEPDSFAQRFARLHGPSICAIAFRVQDAAKAYQQALEKGAWGFDNKTGPMELNIPAIKG
IGDSLIYFVDRWRGKNGAEPNSVGNIDIYDVDFEPIPGANPNPVGHGLTYIDHLTHNVHR
GRMQEWAEFYERLFNFREVRYFDIEGKVTGVKSKAMTSPCGKIRIPINEEGSDTAGQIQE
YLDAYRGEGIQHIALGTNDIYRTVDGLRAANISLLDTIDTYYELVDRRVPNHGEPLDELR
KRKILIDGAPEDLLLQIFTENQIGPIFFEIIQRKGNQGFGEGNFKALFESIELDQIRRGV
VQDKA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtttcaacctgggaaaacccgctcggcaccgacggtttcgagttcatcgaatac
accgcaccggatccgaaggcgctcggcaagctgttcgaacagatgggcttcaccgcgatc
gcgcggcatcgtcataaggacgtgacgctgtatcgccagggggaaatcaactttatcgtc
aacgcggagccggattcgttcgcgcaacgcttcgcgcgtctgcacggcccgtcgatctgc
gcgatcgctttccgcgttcaggacgccgccaaggcgtaccagcaggcgctggaaaaaggc
gcatggggcttcgacaacaaaaccggcccgatggaattgaacattccggcgatcaaaggt
attggcgactcgctgatctatttcgtcgaccgttggcgcggcaagaacggcgccgagccg
aacagcgtcggcaacatcgacatttacgacgtcgacttcgagccgattcccggtgcgaac
ccgaatccggtgggtcatggcctgacctacatcgaccatctgacacacaacgtgcatcgc
ggccgcatgcaggagtgggcggagttctacgagcgcctgttcaatttccgcgaagtgcgc
tatttcgacattgaaggcaaagtgacgggcgtgaagtcgaaggcgatgacctcgccatgc
ggcaagatccgcattccgatcaacgaggaaggttcggacaccgctggccagattcaggaa
tatctcgacgcgtaccgcggcgaaggcattcagcacattgcgctcggcaccaacgacatc
tatcgcacggtggacggcttgcgcgcggcgaacatctcgctgctcgatacgatcgacact
tactatgaactggtcgatcgccgcgtgccgaatcacggcgagccgctggacgagctgcgc
aagcgcaagattctgatcgacggcgcgcccgaagatctgctgctgcagatcttcaccgaa
aaccagatcggcccgattttcttcgagatcattcagcgcaagggcaatcagggctttggc
gaaggcaacttcaaggcgctgttcgaatcgatcgagctggatcagattcgccgtggcgtg
gtgcaggacaaagcctga

DBGET integrated database retrieval system