KEGG   Paraburkholderia xenovorans LB400: Bxe_A0398Help
Entry
Bxe_A0398         CDS       T00340                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00340  Histidine metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Bxe_A0398
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Bxe_A0398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Rieske
Motif
Other DBs
NCBI-ProteinID: ABE32535
JGI: BxeA0398
UniProt: Q13TQ4
Position
1:complement(4438568..4439890)
Genome map
AA seq 440 aa AA seqDB search
MSIKIRKLDSTAPDFQKSLHAVLAFEASEDEAIERSVAQILNDVKARGDAAVLEYTSRFD
RVEAKSVDALELPMSELEAALEGLEPKRRAALEAAAARVRGYHEKQKIECGSHSWRYTEA
DGTVLGQKVTPLDRAGIYVPGGKAAYPSSVLMNAIPARVAGVREIVMVVPTPDGVKNPLV
LAAALLGGVDRVFTIGGAQAVGALAYGTATIPAVDKICGPGNAYVASAKRRVFGTVGIDM
IAGPSEILVLCDGTTDPRWVAMDLFSQAEHDELAQSILLCPDDAFIGRVKDAIDELLPTM
PRRDVISASLEGRGALIKVRDMAEACAIANDIAPEHLEISALEPQQWGQLIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFFKRSSVIEVSAEGAQTLGEIAAELA
YGEGLQAHARSAEYRMRQNG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcaagattcgcaaactcgattccaccgctcccgacttccagaagtcgctgcac
gcggtgctcgcgttcgaggcgagcgaagacgaagcaatcgagcgctcggtcgcgcagatt
ctgaacgacgtgaaggcgcgcggcgatgctgcggtgctggagtacacgagccgcttcgac
cgtgtcgaggcgaagagcgtcgacgcgctcgaactgccgatgtcggagctggaagcggcg
ctggaaggcctcgaaccgaagcgtcgcgcggcgctcgaagcggcggcggcgcgggtgcgc
ggctaccacgagaagcagaagatcgaatgcggcagccatagctggcggtacacggaagcc
gacggcaccgtgctcggccagaaggtcacgccgctcgatcgcgcgggtatctacgtgccg
ggcggcaaggcggcgtatccgtcgtcagtgctgatgaacgcgattccggcgcgagtggcc
ggcgtgcgcgaaatcgtcatggtggtgccgacgccggacggcgtgaagaatccgctggtg
ctcgcggccgcgctgctcggcggcgtggatcgcgtgttcacgattggcggcgcgcaggcg
gtgggcgcgctggcgtacggcacggcgaccattcccgcggtcgacaagatctgcggtccg
ggcaacgcgtacgtcgcgtcggccaagcgccgcgtgttcggcacggtcggtatcgacatg
atcgccgggccgtccgaaatcctggtgctgtgcgacggcaccacggatccgcgctgggtg
gcgatggacctgttctcgcaggccgagcacgacgagctcgcgcagtccattctgctgtgc
ccggacgacgcgttcatcggccgcgtgaaagatgcgatcgacgaactgctgcccaccatg
ccgcgccgcgatgtgatcagcgcgtcgctggaaggccgcggcgcgttgatcaaggtgcgc
gatatggcggaagcctgcgcgatcgccaacgacatcgctccggaacacctcgaaatttcc
gcgctggaaccgcagcagtggggccagctgatccgccatgccggtgcgatctttctcggc
cgctacaccagcgaaagcctcggcgactactgtgcggggccaaatcacgttttgcctacg
tctcgtaccgcacggttctcgtctcctttgggcgtctatgatttcttcaagcgttcgagc
gtgatcgaggtcagcgcggagggcgcgcagacgctgggcgagatcgccgccgaactcgct
tacggcgaaggcctgcaggcgcatgcccgcagcgccgaataccggatgcggcaaaacggc
tga

DBGET integrated database retrieval system