KEGG   Burkholderia xenovorans: Bxe_A0453Help
Entry
Bxe_A0453         CDS       T00340                                 

Definition
thiol-disulfide interchange protein, DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bxe  Burkholderia xenovorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(4386534..4387259)
Genome map
AA seq 241 aa AA seqDB search
MKKTFRIAAAALAIAAVTIGCSAQADQTTDKLKATLQTRLADVTIKSVTKSPIAGLYEVN
LGTQIVYSDANGDYLLLGDMVDAKTRKNLTEARLAETNRIDFASLPFGNAVKVVKGNGAR
KIAVFSDPNCPYCKQLETSLKSIDNVTIYTFLYPVLSPDSTMKSKSIWCSADRAKAWESW
MQDHQAPTAAGTCDTAAIDKNLALGHAMNVDGTPTVFLADGRRLPGAVPADRLDKEMSAV
R
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagactttccgcatcgcggccgccgcgcttgccatcgccgccgtcacgatcggc
tgttcggcacaggccgaccagaccaccgacaagctcaaggccacgctgcaaacgcgtctc
gcggacgtgacgatcaagagcgtgacgaagtcgcccattgccggcctgtacgaagtgaac
ctcggcacgcagatcgtgtatagcgacgcgaacggcgattatctgctgctcggcgacatg
gtcgacgcaaagacccgcaagaatctgaccgaagcgcgcctcgcggaaaccaaccgtatc
gatttcgcgagcctgccgttcggcaatgccgtgaaggtcgtgaagggcaacggcgcgcgc
aagatcgccgtgttctccgacccgaactgcccgtactgcaagcagctcgaaacgtcgctc
aagtcgatcgacaacgtgacgatctataccttcctgtacccggttctgtcgccggactcg
accatgaaatcgaagtcgatctggtgctcggcggaccgcgcgaaggcctgggagtcgtgg
atgcaggaccatcaggcgcccaccgccgccggcacttgcgacaccgccgcgatcgacaaa
aacctcgcgctcggccatgccatgaacgtcgacggcacgcccacggtgttcctcgcggac
ggccgccgtctgcccggcgccgtgccggccgaccggctggacaaggaaatgtccgcggta
cgctga

DBGET integrated database retrieval system