KEGG   Burkholderia xenovorans LB400: Bxe_A0559Help
Entry
Bxe_A0559         CDS       T00340                                 

Definition
guanyl-specific ribonuclease signal peptide protein (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bxe  Burkholderia xenovorans LB400
Brite
Enzymes [BR:bxe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Bxe_A0559
Transfer RNA biogenesis [BR:bxe03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Bxe_A0559
 Prokaryotic Type
    Bxe_A0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(4267247..4267663)
Genome map
AA seq 138 aa AA seqDB search
MARKWQRMKGVLIGAVTLCALSGPVPGAFARDSTALADSNVQLLGTVALAQLPREAVNTL
NLIAAGGPYPYEKDGIVFGNRERLLPAHRRGYYHEYTVPTPRSRNRGARRIVCGGPLKRT
DNCYYSDDHYTSFNRIVE
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggcaacgcatgaaaggcgtgctgatcggtgctgttacgctgtgcgct
ttatccggccccgtgcctggcgcgtttgcgcgcgactccacggcactcgccgactcgaac
gtacagttgctgggcacggtcgcgctggcgcagttgccacgcgaagcggtcaatacattg
aacttgattgccgcaggcgggccttacccgtatgagaaggacggcatcgtattcggcaat
cgcgaacggttgctgccggcccatcggcgcggctattaccacgaatacaccgttcccacg
cctcgctcacgtaatcgcggggcgcgtcgcatcgtctgcggaggtccgctgaagcgaacc
gataattgttactactcggacgaccactacaccagttttaatcgtattgttgaatga

DBGET integrated database retrieval system