KEGG   Burkholderia xenovorans LB400: Bxe_A0616Help
Entry
Bxe_A0616         CDS       T00340                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bxe_A0616 (ruvA)
Enzymes [BR:bxe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Bxe_A0616 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4200212..4200793
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGVLLEKNPPHLLVDCNGVGYEVDVPMSTFYNLPSTGERVVLLTQMIVREDAHLL
YGFGTAEERSTFRELLKISGIGARMALAVLSGMSVHELAQTVTMQDAARLTRVPGIGKKT
AERLLLELKGKIGADLGAMAGAASASDHASDILNALLALGYSEKEALAAVKNVPAGTGVS
EGIKLALKALSKG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcattgccggcgttctgctggaaaaaaacccgccgcatctgctcgtcgac
tgcaacggcgtcggttacgaagtcgatgtgccgatgagcacgttctacaacctgccctcc
accggcgaacgcgtggtgttgctcacgcagatgatcgtgcgcgaagacgcacacctgctc
tacggcttcggcaccgccgaggaacgctcgaccttccgcgaactgctgaaaatctccggc
atcggcgcacgcatggcgctggcggtgctgtcgggcatgagcgtccacgagctcgcgcaa
accgtcacgatgcaggacgcggcgcgtctgacgcgcgtgccgggcatcggcaagaagacg
gcggagcggctgctcctcgaactgaagggcaagatcggcgcagacctgggcgcaatggcg
ggcgcggcgtcggcatccgaccacgcctccgacattctgaacgcactactcgcattgggt
tactccgaaaaagaagcgttggccgccgtcaagaacgtgccggccggcaccggcgtttcc
gagggcatcaagctcgcattgaaggcgctgtccaagggctga

DBGET integrated database retrieval system