KEGG   Burkholderia xenovorans: Bxe_A0638Help
Entry
Bxe_A0638         CDS       T00340                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bxe  Burkholderia xenovorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bxe00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4177114..4178613
Genome map
AA seq 499 aa AA seqDB search
MQDQYILALDQGTTSSRAMLFDRLGNIVSTAQKEFQQIYPRPGWVEHDPQEIWSTQAGVA
AEAVTRAGMNGTSIAAIGITNQRETTIVWDRETGHPIYNAIVWQDRRTADFCDQLKEQGL
EEKVRAKTGLPIDSYFSATKIRWILDNVEGAREKAKQGRLAFGTVDSWLVWNFTKGGLHI
TDVTNASRTMLFNIHSLKWDDELLEALDIPRSMLPEVRASSETYGPTKTTVFASKIPLAG
IAGDQHAALFGQMCTESGMVKNTYGTGCFLVMNTGDKPIESKNNLVTTIAWQIGDQINYA
LEGSIFIGGAVVQWLRDGLGIIRNAAEIETLARSVPHCDGVYLVPAFAGLGAPHWNARAR
GTLFGVTRGTSSAHIARAALDSIAYQSVDVLKAMEADSGIRIGELRVDGGACANNLLMQF
QADILGVDAVRPKVSETTALGAAYLAGLAVGYWKDVDELQSQWKLDRRFTPALPHAEVKA
CLDGWKRAIRAAKAWADTP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatcagtacattctcgcgcttgaccaaggcaccaccagctcgcgcgcgatgctg
ttcgaccggctcggcaatatcgtgtcgaccgcccagaaggaattccagcaaatctacccg
cgtccgggttgggtcgagcacgatccgcaggaaatctggtcgacccaggccggcgtcgcc
gccgaggccgtgacgcgcgccggcatgaacggcacctcgatcgccgcgatcggcatcacc
aatcagcgcgaaaccaccatcgtatgggatcgcgaaaccggccatcccatctataacgcg
atcgtctggcaggaccgccgcactgcggacttctgcgaccagctcaaggagcaggggctc
gaagaaaaagtccgcgcgaaaaccggcctgccgatcgattcgtatttctcggcgaccaag
atccgctggattctcgacaacgtcgaaggtgcgcgcgaaaaagccaaacaggggcgtctt
gcgttcggcaccgtcgatagctggctggtgtggaatttcaccaagggcggcctgcatatc
accgacgtcaccaacgcgtcgcgcacgatgctgttcaacatccactcgctgaagtgggac
gacgaactgctcgaagcgctcgacattccgcgcagcatgctgccggaagtgcgcgcttcg
tcggaaacgtatgggccgaccaagaccaccgtgttcgcttcgaagattccgctcgcgggc
attgccggcgatcagcacgccgcgctcttcggccagatgtgcacggagtcgggcatggtg
aagaacacctacggcacgggctgcttcctcgtgatgaacaccggcgacaagccgatcgaa
tcgaagaacaatctcgtcaccacgatcgcgtggcagatcggcgaccagatcaattacgcg
ctggaaggcagcatcttcattggcggcgccgtggtgcagtggctgcgcgacggcctcggg
atcatcaggaacgccgctgaaatcgaaacgctggcgcgcagtgtgccgcattgcgacggc
gtgtatctggtgccggccttcgccggtctcggcgcgccgcactggaatgcgcgcgctcgc
ggcacgctgttcggcgtgacgcgtggcacgtcgtcggcgcatatcgcacgcgcggcgctc
gactcgatcgcttatcaatcggtcgacgtactgaaggcgatggaagccgactccggcatt
cgcatcggcgaattgcgggtggacggcggcgcctgcgcgaacaatctgctgatgcaattc
caggcggacattctcggcgtcgacgccgtgcgtcccaaggtgtcggaaacgacagcattg
ggtgccgcttatctggccggtctcgcggtgggttactggaaagatgtcgacgagctgcaa
agccagtggaaactcgaccgccgcttcacgcctgccctgccgcacgccgaggtcaaggca
tgcctcgacggctggaagcgcgcgatccgcgccgcgaaggcgtgggccgatacaccctga

DBGET integrated database retrieval system