KEGG   Burkholderia xenovorans: Bxe_A0769Help
Entry
Bxe_A0769         CDS       T00340                                 

Definition
superoxide dismutase (EC:1.15.1.1)
Orthology
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bxe  Burkholderia xenovorans
Brite
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Bxe_A0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(4033504..4034082)
Genome map
AA seq 192 aa AA seqDB search
MEHTLPPLPFAKNALVPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEEIVKKA
SGGVFNNAAQVWNHTFFWNSLSPQGGGAPSGALADAINARWGSFDKFKEEFAKTAVGTFG
SGWAWLVKKPDGSLDLVSTSNAATPLTTDAKALLTIDVWEHAYYIDYRNARPKFVEAYWN
IVNWEFASKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaacatacgctcccaccgctgccgttcgcgaaaaacgcactcgttccgcacatgtcg
gaagagacgctcgagtttcactacggcaagcatcaccagacctatgtgaccaacctgaac
aatctgatcaagggcacggagttcgagaatctgtcgctcgaggaaatcgtcaagaaggca
tcgggcggcgtattcaacaacgcggctcaagtgtggaatcacacgttcttctggaacagc
ctgtcgccgcaaggtggtggtgctccgagcggcgcgctcgccgacgcgatcaacgccagg
tggggttcgttcgacaagttcaaggaagaattcgccaagaccgcagtcggcacgttcggc
tcgggttgggcatggctggtgaagaagcccgacggttcgctcgacctcgtgtcgacgagc
aacgccgccacgccgctgaccaccgacgcgaaagcgctgctgaccatcgacgtctgggaa
cacgcttactacatcgattaccgcaatgcgcgtccgaagttcgtcgaagcgtactggaac
atcgtcaactgggaattcgcgtcgaagaatttcgcgtga

DBGET integrated database retrieval system